Recombinant Human Beta-1,4-galactosyltransferase 2(B4GALT2)

Code CSB-CF002514HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O60909
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSARGPAHALHPAASSSSSSSNCSRPNATASSSGLPEVPSALPGPTAPTLPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPPSWPPRG
Source in vitro E.coli expression system
Gene Names B4GALT2
Protein Names Recommended name: Beta-1,4-galactosyltransferase 2 Short name= Beta-1,4-GalTase 2 Short name= Beta4Gal-T2 Short name= b4Gal-T2 EC= 2.4.1.- Alternative name(s): UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2 UDP-galactose:beta-N-ace
Expression Region 1-372
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids. Can produce lactose.
Subcellular Location Golgi apparatus, Golgi stack membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 7 family
Tissue Specificity Weakly expressed in various tissues. Highest expression in prostate, testis, ovary, intestine, muscle, and in fetal brain.
Database Links

HGNC: 925

OMIM: 604013

KEGG: hsa:8704

STRING: 9606.ENSP00000310696

UniGene: Hs.632403

Related Products

B4GALT2 Antibodies

B4GALT2 Antibodies for Homo sapiens (Human)

B4GALT2 Antibodies for Human

B4GALT2 Proteins

B4GALT2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.