Recombinant Human C-C chemokine receptor-like 2(CCRL2)

Code CSB-CF004852HU
Size Pls inquire other sizes
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names CCRL2
Uniprot No. O00421
Alternative Names C-C chemokine receptor-like 2; CCRL2; CCRL2_HUMAN; Chemokine (C-C motif) receptor like 2; Chemokine receptor CCR11; Chemokine receptor X; CKRX; CRAM A; CRAM B; CRAMA; CRAMB; FLJ55815; HCR; MGC116710; MGC34104; Putative MCP 1 chemokine receptor ; Putative MCP-1 chemokine receptor
Species Homo sapiens (Human)
Expression Region 1-344
Target Protein Sequence MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVV LILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFF NCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYK CAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLV FAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLY AFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
Protein Length Full length protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. Plays a critical role for the development of Th2 responses.
Gene References into Functions
  1. CCRL2 mRNA was not significantly changed in murine and human non-alcoholic steatohepatitis liver. CCRL2 mRNA levels were positively correlated with inflammation, fibrosis and NASH scores in the patients. PMID: 28600126
  2. CCRL2 inhibited the growth of breast cancer cells in vitro and in vivo. PMID: 26487662
  3. in breast cancer, CRAM-A becomes specifically upregulated under inflammatory stimuli and may serve as a potential marker of immune response. PMID: 26563945
  4. these results suggest for the first time that elevated CCRL2 in glioma promotes cell migration and invasion. PMID: 23142225
  5. Considering the newly defined role of CCRL2 in lung dendritic cell trafficking, this atypical chemokine receptor may affect pneumocystis pneumonia through immune regulation and inducing inflammation. PMID: 22046140
  6. demonstration that the homeostatic chemokine CCL19 is a specific ligand for CRAM PMID: 20002784
  7. CCRL2 expression is up-regulated on synovial neutrophils of rheumatoid arthritis patients PMID: 15188357
  8. Results identify chemerin as a natural nonsignaling protein ligand for both human and mouse CCRL2. PMID: 18794339

Show More

Hide All

Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed abundantly in immunal tissues such as spleen, fetal liver, lymph node and bone marrow. Strong expression also in lung and heart. Expressed in almost all hematopoietic cells including monocytes, macrophages, PMNs, T-cells (both CD4+ and CD8+), mo
Database Links

HGNC: 1612

OMIM: 608379

KEGG: hsa:9034

STRING: 9606.ENSP00000349967

UniGene: Hs.535713

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1