Recombinant Human CAAX prenyl protease 2(RCE1)

Code CSB-CF896686HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9Y256
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSEL PRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPL LLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFR ACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVF GAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQ PLTDPKLYGSLPLCVLLERAGDSEAPLCS
Source in vitro E.coli expression system
Gene Names RCE1
Protein Names Recommended name: CAAX prenyl protease 2 EC= 3.4.22.- Alternative name(s): Farnesylated proteins-converting enzyme 2 Short name= FACE-2 Prenyl protein-specific endoprotease 2 RCE1 homolog Short name= hRCE1
Expression Region 1-329
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. Seems to be able to process K-Ras, N-Ras, H-Ras, RAP1B and G-gamma-1
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Peptidase U48 family
Tissue Specificity Ubiquitous.
Database Links

HGNC: 13721

OMIM: 605385

KEGG: hsa:9986

STRING: 9606.ENSP00000309163

UniGene: Hs.654972

Related Products

RCE1 Antibodies

RCE1 Antibodies for Human

RCE1 Proteins

RCE1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.