Recombinant Human Calcitonin receptor (CALCR)

Code CSB-CF004439HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CALCR; Calcitonin receptor; CT-R
Species
Homo sapiens (Human)
Expression Region
25-490
Target Protein Sequence
AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDD TPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKN AYVLYYLAIVGHSLSIFTLVISLGIFVFFRKLTTIFPLNWKYRKALSLGCQRVTLHKNMF LTYILNSMIIIIHLVEVVPNGELVRRDPVSCKILHFFHQYMMACNYFWMLCEGIYLHTLI VVAVFTEKQRLRWYYLLGWGFPLVPTTIHAITRAVYFNDNCWLSVETHLLYIIHGPVMAA LVVNFFFLLNIVRVLVTKMRETHEAESHMYLKAVKATMILVPLLGIQFVVFPWRPSNKML GKIYDYVMHSLIHFQGFFVATIYCFCNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARA AAAAAEAGDIPIYICHQEPRNEPANNQGEESAEIIPLNIIEQESSA
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin.; Receptor for calcitonin but is unable to couple to G proteins and activate adenylyl cyclase. Does not undergo receptor internalization following ligand binding.
Gene References into Functions
  1. CTR activates AKAP2-anchored cAMP-dependent protein kinase A, which then phosphorylates tight junction proteins ZO-1 and claudin 3. PMID: 28428082
  2. structure of a full-length class B receptor, the calcitonin receptor, in complex with peptide ligand and heterotrimeric Galphasbetagamma protein determined by Volta phase-plate single-particle cryo-electron microscopy PMID: 28437792
  3. Data suggest that a single GlcNAc residue at CTR N130 (asparagine 130) is responsible for enhanced affinity of calcitonin for CTR ECD; the same appears to apply for enhanced affinity of amylin for RAMP2-CTR ECD. [GlcNAc = N-acetylglucosamine; CTR = calcitonin receptor; ECD = extracellular domain; RAMP2 = receptor (calcitonin) activity modifying protein 2]. PMID: 28614667
  4. Males with CALCR TT genotype (rs1801197) have 13 fold increased risk for kidney stone disease. No significant association of rs1042138 with kidney stone in West Bengal, India. PMID: 28435134
  5. Calcitonin and Amylin Receptor Peptide Interaction Mechanisms: INSIGHTS INTO PEPTIDE-BINDING MODES AND ALLOSTERIC MODULATION OF THE CALCITONIN RECEPTOR BY RECEPTOR ACTIVITY-MODIFYING PROTEINS. PMID: 26895962
  6. An association between fluorosis and the Alu I polymorphism in the CTR gene was observed in fluoride-exposed populations. PMID: 25402775
  7. The C1377T polymorphism in the CTR gene is associated with bone mineral density at the lumbar spine in a postmenopausal Han Chinese population PMID: 25055932
  8. There was no statistically significant difference in CTR gene nucleotide sequence polymorphisms at 1377-bp between Chinese Xinjiang Han and Uygur patients with primary osteoporosis. PMID: 24522475
  9. Data indicate a potential association between 3'UTR+18C>T and intron 1 polymorphisms in the CALCR and the risk of kidney stone disease. PMID: 24296906
  10. Prolonged calcitonin receptor signaling by salmon, but not human calcitonin, reveals ligand bias. PMID: 24643196
  11. High calcitonin receptor is associated with prostate cancer. PMID: 23820954
  12. CTR was expressed by glioma cells in a majority of GBM tumours tested. PMID: 22335784
  13. Allele C in CALCR gene was associated with reduced bone mass in cystic fibrosis children. PMID: 21462477
  14. highly expressed on normal T- and B-lymphocytes PMID: 19445988
  15. Activation of calcitonin receptor and calcitonin receptor-like receptor by membrane-anchored ligands. PMID: 19903822
  16. relationship between calcitonin receptor (CTR) genotype and buccal marginal bone loss observed at stage II surgery for endosseous implants PMID: 11858573
  17. an important role for filamin in the endocytic sorting and recycling of the internalized CTR PMID: 12531889
  18. Co-expression of calcitonin receptors (CT) lacking a portion of domain 1 with receptor activity-modifying protein (RAMP) 1, 2, or 3 appears to produce functional CT-(8-32)-sensitive adrenomedullin receptors. PMID: 12565884
  19. ALUI calcitonin receptor polymorphism genotype showed a positive association with prevalence of osteoporosis in the subjects PMID: 12771454
  20. analysis of the amino terminus of the calcitonin receptor and its effects on docking constraints PMID: 14583624
  21. the site of attachment of a photoaffinity label was identified as residue Leu(348) within the third extracellular loop of the receptor PMID: 15155765
  22. existence of two novel splice variants of human CTR and splicing patterns could be involved in the post-transcriptional regulation of the gene. PMID: 15563840
  23. Effects of VDR (Fok-I) and CTR gene polymorphism contribute to understanding of pathogenesis of urinary calculi. Potential candidate gene in search for genetic causes of paediatric calcium oxalate nephrolithiasis. PMID: 15856322
  24. normal cell surface expression, mobilization of intracellular calcium, and Erk activation requires the cytoplasmic C-terminal tail of the CTR PMID: 15860547
  25. The calcitonin receptor model is consistent with cooperative interaction between the receptor amino terminus and the receptor core. PMID: 15929987
  26. the MCP-1-induced TRAP(+)/CTR(+) multinuclear cells represent an arrested stage in osteoclast differentiation, after NFATc1 induction and cellular fusion but prior to the development of bone resorption activity PMID: 16280328
  27. up-regulation of CT biosynthesis and activation of CT-CTR axis in primary prostate tumors may have direct relevance in their progression to the metastatic phenotype. PMID: 17487556
  28. Study data suggest that the AluI polymorphism of the CTR gene can be useful as a genetic marker in the interindividual susceptibility of QUS parameters by the interaction with nutritional status as a lifestyle factor. PMID: 17709929
  29. High calcitonin receptor is associated with multiple myeloma PMID: 17714780
  30. BsmI and AluI polymorphisms are not related to the forearm bone values either reflecting mass or geometrical variables in this male population. PMID: 18622089
  31. the juxtamembranous region of the amino terminus of the family B G protein-coupled calcitonin receptor plays a critical role in small-molecule agonist action PMID: 19447889

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Database Links

HGNC: 1440

OMIM: 114131

KEGG: hsa:799

STRING: 9606.ENSP00000352561

UniGene: Hs.489127

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1