Recombinant Human Chloride intracellular channel protein 4 (CLIC4)

Code CSB-CF897583HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CLIC4
Uniprot No.
Alternative Names
Chloride intracellular channel 4; Chloride intracellular channel 4 (mitochondrial); Chloride intracellular channel 4 like; Chloride intracellular channel protein 4; Clic4; CLIC4_HUMAN; CLIC4L; DKFZP566G223; FLJ38640; H1; HUH1; Intracellular chloride ion channel protein p64H1; MC3S5; mtCLIC; p64H1
Species
Homo sapiens (Human)
Expression Region
2-253
Target Protein Sequence
ALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKR KPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDI FAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDG NEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVE IAYSDVAKRLTK
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Promotes cell-surface expression of HRH3. Has alternate cellular functions like a potential role in angiogenesis or in maintaining apical-basolateral membrane polarity during mitosis and cytokinesis. Could also promote endothelial cell proliferation and regulate endothelial morphogenesis (tubulogenesis).
Gene References into Functions
  1. Results provide evidence that the G4 structure formed in the CLIC4 promoter region may act as a regulatory element in regulating CLIC4 gene transcription. PMID: 30201851
  2. CLIC4 and Ihh could serve as biological markers for the progression, metastasis and/or invasiveness of pancreatic ductal adenocarcinoma. PMID: 28205343
  3. in malignant pleural mesothelioma, the gene expressions of CLIC3 and CLIC4 were significantly increased compared to controls PMID: 26445368
  4. CLIC1 and CLIC4 are overexpressed in specific tumor types or their corresponding stroma and change localization and function from hydrophilic cytosolic to integral transmembrane proteins. (Review) PMID: 25546839
  5. CLIC4 knockdown decreases cell-matrix adhesion, cell spreading and integrin signaling, whereas it increases cell motility. PMID: 25344254
  6. This study investigated the proteome modulated by oncogenic KRAS in immortalized airway epithelial cells. PMID: 24503901
  7. Increased CLIC4 expression is an early manifestation and mediator of endothelial dysfunction in pulmonary hypertension. PMID: 24503951
  8. CLIC4 increases tumor cell migration and invasion in a TGF-beta-dependent manner. PMID: 23416981
  9. In addition to CLIC1 and TPM1, which were the proteins initially discovered in a xenograft mouse model, CLIC4, TPM2, TPM3, and TPM4 were present in ovarian cancer patient sera at significantly elevated levels compared with controls. PMID: 23792823
  10. Our data indicate that CLIC4 protein may be a key element in the apoptotic response to oxidative stress. PMID: 23380911
  11. These results demonstrate that CLIC4 nuclear translocation is an integral part of the cellular response to starvation. PMID: 22761775
  12. Reduced CLIC4 expression and nuclear residence detected in cancer cells is associated with the altered redox state of tumor cells and the absence of detectable nuclear CLIC4 in cancers contributes to TGF-beta resistance and enhances tumor development. PMID: 22387366
  13. CLIC4 may not be responsible for benign familial infantile seizures (BFIS) in a Chinese family affected with BFIS. PMID: 20374090
  14. Data suggest that CLIC4 is regulated by RhoA to be targeted to the plasma membrane, where it may function not as an inducible chloride channel but rather by displaying Cys-dependent transferase activity toward a yet unknown substrate. PMID: 19776349
  15. CLIC4 functions to promote endothelial cell proliferation and to regulate endothelial morphogenesis, and is thus involved in multiple steps of in vitro angiogenesis. PMID: 19247789
  16. CLIC4 is differentially regulated in fibroblasts and its expression contributes to a myofibroblast phenotype PMID: 12163372
  17. CLIC4 has alternate cellular functions that are distinct from their proposed roles as chloride channels PMID: 14569596
  18. subcellular localization of CLIC4 in endothelial cells was dependent on whether cells were engaged in proliferation or tube formation PMID: 16239224
  19. up-regulation of mitochondrial CLIC4, together with a reduction in Bcl-2 and Bcl-xL, sensitizes Myc-expressing cells to the proapoptotic action of Bax. PMID: 16316993
  20. preliminary crystallographic analysis PMID: 16842122
  21. CLIC4 in tumor stroma has a role in myofibroblast conversion in human neoplasms PMID: 17200346
  22. Nuclear CLIC4, possibly by altering the Cl(-) and pH of the nucleus, contributes to cell cycle arrest and the specific gene expression program associated with keratinocyte terminal differentiation. PMID: 17636002
  23. Data showed that CLIC1 and CLIC5, but not CLIC4, were strongly and reversibly inhibited (or inactivated) by F-actin. PMID: 18028448
  24. ROS-initiated CLIC4 up-regulation is required for TGF-beta1-induced fibroblast-to-myofibroblast transdifferentiaton in ovarian cancer. PMID: 19639201
  25. S100A4 and bone morphogenetic protein-2 codependently induce vascular smooth muscle cell migration via phospho-extracellular signal-regulated kinase and chloride intracellular channel 4. PMID: 19713532

Show More

Hide All

Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasmic vesicle membrane; Single-pass membrane protein. Nucleus matrix. Cell membrane; Single-pass membrane protein. Mitochondrion. Cell junction. Note=Colocalized with AKAP9 at the centrosome and midbody. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain. Present in an intracellular vesicular compartment that likely represent trans-Golgi network vesicles.
Protein Families
Chloride channel CLIC family
Tissue Specificity
Detected in epithelial cells from colon, esophagus and kidney (at protein level). Expression is prominent in heart, kidney, placenta and skeletal muscle.
Database Links

HGNC: 13518

OMIM: 606536

KEGG: hsa:25932

STRING: 9606.ENSP00000363500

UniGene: Hs.440544

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1