Recombinant Human Claudin-10 (CLDN10)

Code CSB-CF005491HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CLDN10
Uniprot No.
Alternative Names
CLDN10; Claudin-10; Oligodendrocyte-specific protein-like; OSP-like
Species
Homo sapiens (Human)
Expression Region
1-228
Target Protein Sequence
MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGV SNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLA GIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFC FSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Involved in the regulation of paracellular epithelia permeability to ions in multiple organs. It acts as a paracellular ion channel probably forming permselective pores; isoform 1 appears to create pores preferentially permeable to cations and isoform 2 for anions. In sweat glands and in the thick ascending limb (TAL) of Henle's loop in kidney, it controls paracellular sodium permeability which is essential for proper sweat production and renal function.
Gene References into Functions
  1. The CLDN10 polymorphism of rs1325774 was significantly associated with an increased risk of breast cancer. After adjusting for age, the association remained statically significant. Furthermore, harbouring G allele in rs1325774 position was significantly associated with increased risk of breast cancer. However, no significant association among rs7333503, rs3751334, and breast cancer. PMID: 30544377
  2. These renal-derived features recapitulate several phenotypic aspects detected in mice with kidney specific loss of both claudin-10 isoforms. Our study adds to the spectrum of phenotypes caused by tight junction proteins and demonstrates a pivotal role for claudin-10b in maintaining paracellular Na+ permeability for sweat production and kidney function. PMID: 28686597
  3. localization of Cldn3, Cldn7 and Cldn10 proteins in the different compartments of murine endometrium up to day 8.5 of pregnancy (dpc) as well as in human endometrium and first trimester decidua PMID: 26340953
  4. Expression of CLDN1 and CLDN10 was lower in invasive lepidic predominant adenocarcinoma than in lung adenocarcioma in situ. Overexpression of CLDN1 and CLDN10 indicates a favorable prognosis in some patients with lung adenocarcinoma. PMID: 23591077
  5. Claudin 10 expression was down-regulated in gastric cancer. PMID: 24325792
  6. In claudin-10b, the F66L mutant reduced cation selectivity, and the F66A mutant lost pore conductance PMID: 23760508
  7. Claudin 10/18 are most commonly expressed in lung adenocarcinomas. Female patients and non-smokers express these claudins more commonly suggesting that they may play a part in the carcinogenesis of tobacco unrelated carcinoma. PMID: 22076167
  8. Claudin 10 protein is highly expressed in hepatocellular carcinoma (HCC) tissue and is closely related to angiogenesis. It could be a useful marker to predict poor prognosis of HCC patients after hepatectomy. PMID: 21647678
  9. CLDN10 is a novel biomarker for detecting ovarian cancer in the chicken, a suitable animal model for investigating the effect and function of CLDN in human ovarian cancer. PMID: 21370593
  10. High Claudin-10 expression level is associated with recurrence of primary hepatocellular carcinoma PMID: 15701840
  11. These findings showed that CLDN-10 is functionally involved in hepatocellular carcinoma invasion and is a potential target for hepatocellular carcinoma therapy. PMID: 18025272
  12. Claudin-10 exists in six alternatively spliced isoforms that exhibit distinct localization and function. PMID: 19383724

Show More

Hide All

Involvement in disease
HELIX syndrome (HELIX)
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Tissue Specificity
Expressed in the kidney, eccrine sweat glands and in all layers of the epidermis. In the kidney, it is detected in the thick ascending limb of Henle's loop (TAL). In the sweat glands, it is expressed in cells from secretory portions, corresponding to the
Database Links

HGNC: 2033

OMIM: 617579

KEGG: hsa:9071

STRING: 9606.ENSP00000299339

UniGene: Hs.534377

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×