Recombinant Human Claudin-2 (CLDN2)

Code CSB-CF005500HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CLDN2
Uniprot No.
Alternative Names
CLDN2; PSEC0059; SP82; UNQ705/PRO1356; Claudin-2; SP82
Species
Homo sapiens (Human)
Expression Region
1-230
Target Protein Sequence
MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTG ITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVA GGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGII LCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References into Functions
  1. CLDN2 may have a role regulating tissue-specific physiological properties in tight junctions in UC. PMID: 29040430
  2. the accumulation of DXR into spheroids was enhanced by claudin-2 knockdown, resulting in a reduction in cell viability. We suggest that claudin-2 may be a novel therapeutic target in lung adenocarcinoma, because claudin-2 knockdown increased the accumulation of anticancer agents in cancer cells and spheroids. PMID: 29247669
  3. integration of claudin-2, occludin and ZO-1 is necessary for maintaining the function of the proximal tubular epithelium. PMID: 29252987
  4. these findings provide a novel mechanism by which microbial-derived butyrate promotes barrier through IL-10RA-dependent repression of claudin-2 PMID: 28893958
  5. Low CLDN2 expression is associated with Lung Cancer metastasis. PMID: 28754672
  6. results reveal that IL-22 increases intestinal epithelial permeability by upregulating Claudin-2 expression through the JAK/STAT pathway PMID: 28939759
  7. In summary, we demonstrate that TCPTP protects the intestinal epithelial barrier by restricting STAT-induced claudin-2 expression. PMID: 28804910
  8. The cation channel-forming tight junction protein claudin-2 was shown to permit the paracellular passage of water through its pore. PMID: 28636801
  9. suggest that epigenetic inhibitors suppress the abnormal proliferation of lung adenocarcinoma cells highly expressing claudin-2 PMID: 28057758
  10. Data show that alterations in myosin light chain kinase activity, claudin-15 and claudin-2 expression are associated with gluten-induced symptomatology and intestinal permeability changes in diarrhea-predominant irritable bowel syndrome (IBS-D). PMID: 27869798
  11. hypotonic stress induces dephosphorylation, clathrin-dependent endocytosis, and degradation of claudin-1 and -2 in lysosomes, resulting in disruption of the TJ barrier in renal tubular epithelial cells. PMID: 27733684
  12. The claudin-2 expression increased in tumor necrosis factor alpha (TNF-alpha) Treated Caco-2 cell monolayers. PMID: 28106723
  13. The authors conclude that claudin-2 forms gated paracellular channels. PMID: 26568313
  14. Association of claudin2 (rs7057398) polymorphism with idiopathic recurrent acute pancreatitis and progression of the disease to chronic pancreatitis. PMID: 26110235
  15. Genetic variants in CLDN2 and MORC4 genes were associated with chronic pancreatitis in Indian patients. PMID: 26820620
  16. Quercetin decreases claudin-2 expression mediated by up-regulation of miR-16 expression and instability of claudin-2 mRNA in lung adenocarcinoma cells. PMID: 26061016
  17. Pan-inhibition of SFK signaling pathways elevated Claudin-2 expression levels in breast cancer cells. Loss of Yes or Fyn induces Claudin-2 expression; whereas, diminished Lyn levels impairs Claudin-2 expression in breast cancer cells. PMID: 25823815
  18. PKCiota binds to Rab14 and that PKCiota requires Rab14 for its correct distribution in cells. As with Rab14, PKCiota protects claudin-2 from lysosomal degradation and, in consequence, modulates epithelial barrier. PMID: 25694446
  19. Phosphorylation state of the tyrosine of claudin-1 and claudin-2 regulates interaction with ZO1. PMID: 26023235
  20. Single nucleotide polymorphism is associated with the development of alcoholic pancreatitis. PMID: 25253127
  21. TNF--alpha modifies claudin-2 expression in tubular cells and this can have both short-term and long-term effects on transport and barrier functions. PMID: 25948735
  22. Claudin-5 overexpression promoted the interactions of claudin-1 and claudin-2 and enhanced the barrier function of retinal cells. PMID: 25323998
  23. Claudins 2 and 4 have reciprocal effects on epithelial barrier function, exhibit differential FRAP dynamics, and compete for residency within the tight junction. PMID: 25031428
  24. Autophagy reduces the paracellular permeability of small solutes and ions via degradation of the pore-forming tight junction protein claudin-2. PMID: 25616664
  25. Decreased claudin-2 enhances endothelial barrier function and may play a role in the prolonged survival of patients with Kaposi sarcoma-associated herpesvirus and HIV co-infection. PMID: 24995964
  26. IL-6 modulation of intestinal TJ permeability was regulated by JNK activation of AP-1 and AP-1 activation of claudin-2 gene PMID: 24662742
  27. Suggest that claudin 2 is involved in paracellular water transport and that claudin 2 expression is sensitive to compound induced cellular stress. PMID: 24907557
  28. The expression of claudin-2 was down regulated in gastric cancer tissue. PMID: 23919729
  29. In breast cancer patients CLDN2 was significantly up-regulated (P < 0.001) in liver metastases compared to other metastatic sites. PMID: 24287398
  30. Proliferation of human adenocarcinoma A549 cells was decreased by claudin-2 knockdown together with a decrease in the percentage of S phase cells. PMID: 24907662
  31. Report altered claudin 1 expression when comparing normal skin to actinic keratosis and squamous cell carcinoma of the skin. PMID: 24294371
  32. Helicobacter pylori-induced tumorigenesis and invasiveness of gastric carcinoma cells is mediated by bacterial CagA via Cdx2-dependent targeting of Claudin-2. PMID: 24287273
  33. Findings suggest that a variant of the CLDN2-MORC4 region predisposes to Crohn's disease in a Swedish population. PMID: 23946598
  34. Claudin-2 protein expression is elevated in intestinal epithelia, in response to bovine colostrum, without altering ion permeability. PMID: 23717570
  35. generated MDCK I Tet-off cells stably transfected with claudin-2 Tyr(67) mutants. The Y67L mutant showed reduced cation selectivity compared with wild-type claudin-2 due to a decrease in Na(+) permeability, without affecting the Cl(-) permeability PMID: 23760508
  36. Claudin-2 assumes an important role in colorectal inflammation, and furthermore implicates the involvement of MLCK in colon inflammation. PMID: 23306855
  37. Sinonasal epithelium in allergic fungal rhinosinusitis displays increased epithelial permeability and an altered expression of claudin-2 PMID: 22927233
  38. results implicate pericryptal myofibroblast-derived paracrine KGF and largely autocrine amphiregulin in the upregulation of claudin-2 in Caco-2 epithelial monolayers and consequent disruption of tight junction integrity PMID: 22946653
  39. Two associations with alcoholic pancreatitis at genome-wide significance were identified and replicated at PRSS1-PRSS2 and X-linked CLDN2 through a two-stage genome-wide study. PMID: 23143602
  40. These results suggest that EGF is secreted from A549 cells by MMP and increases claudin-2 expression mediated via the activation of an EGFR/MEK/ERK pathway. PMID: 22546605
  41. Pore-forming tight junction protein claudin-2 is strongly expressed in the ileum of 51% patients in quiescent phase and in 49% of the patients with active Crohn's disease. PMID: 21688348
  42. demonstrate here that breast cancer cells harbouring PIK3CA mutations are selectively sensitive to mTOR allosteric and kinase inhibitors. However, cells with PTEN loss of function are not sensitive to these drugs PMID: 21383692
  43. CLDN2 is selectively enriched in and promotes the formation of breast cancer liver metastases through engagement of cell membrane complexes. PMID: 21076473
  44. The authors propose claudin-2 and SYN1 work in concert to enhance microbial translocation across the intestinal epithelial barrier to contribute to chronic immune activation and CD4 T-cell depletion in HIV-1-infected patients. PMID: 20700059
  45. claudin-2 was not expressed in any of the 18 cases of Epstein-Barr virus-associated nasopharyngeal carcinoma studied. PMID: 20204275
  46. CLDN 2 expression was significantly increased in severe form of coeliac disease in bulb and in distal duodenum PMID: 20143085
  47. Cloning of the human claudin-2 5'-flanking region revealed a TATA-less promoter with conserved binding sites in mouse and human for caudal-related homeodomain proteins and hepatocyte nuclear factor-1alpha. PMID: 11934881
  48. Results support a model in which claudins 2 and 4 create paracellular channels and the first extracellular domain is sufficient to determine both paracellular charge selectivity and transepithelial electrical resistance. PMID: 12700140
  49. role for the paracellular barrier function by opening pores for small cations PMID: 14751232
  50. optimal claudin-2 expression in the gut relies on the presence of GATA-4, suggesting a role for this factor in intestinal regionalization PMID: 15389642

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Database Links

HGNC: 2041

OMIM: 300520

KEGG: hsa:9075

STRING: 9606.ENSP00000336571

UniGene: Hs.522746

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1