Recombinant Human Claudin-5(CLDN5)

Code CSB-CF005507HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O00501
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
Source in vitro E.coli expression system
Gene Names CLDN5
Protein Names Recommended name: Claudin-5Alternative name(s): Transmembrane protein deleted in VCFS Short name= TMDVCF
Expression Region 1-218
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a major role in tight junction-specific obliteration of the intercellular space.
Subcellular Location Cell junction, tight junction, Cell membrane, Multi-pass membrane protein
Protein Families Claudin family
Database Links

HGNC: 2047

OMIM: 602101

KEGG: hsa:7122

STRING: 9606.ENSP00000384554

UniGene: Hs.505337

Related Products

CLDN5 Antibodies

CLDN5 Antibodies for Homo sapiens (Human)

CLDN5 Antibodies for Human

CLDN5 Proteins

CLDN5 Proteins for Homo sapiens (Human)

CLDN5 ELISA Kit

CLDN5 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.