Recombinant Human Collagen alpha-3(VI) chain(COL6A3),partial

Code CSB-CF005753HUa6
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P12111
Relevance Collagen VI acts as a cell-binding protein.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence HKQVNVPNNVTSSPTSNPVTTTKPVTTTKPVTTTTKPVTTTTKPVTIINQPSVKPAAAKPAPAKPVAAKPVATKMATVRPPVAVKPATAAKPVAAKPAAVRPPAAAAAKPVATKPEVPRPQAAKPAATKPATTKPMVKMSREVQVFEITENSAKLHWERAEPPGPYFYDLTVTSAHDQSLVLKQNLTVTDRVIGGLLAGQTYHVAVVCYLRSQVRATYHGSFSTKKSQPPPPQPARSASSSTINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMG
Research Area Cancer
Source in vitro E.coli expression system
Gene Names COL6A3
Expression Region 2853-3176aa
Tag Info N-terminal 6xHis-B2M-tagged
Mol. Weight 48.5 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Collagen VI acts as a cell-binding protein.
Involvement in disease Bethlem myopathy 1 (BTHLM1); Ullrich congenital muscular dystrophy 1 (UCMD1); Dystonia 27 (DYT27)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Type VI collagen family
Database Links

HGNC: 2213

OMIM: 120250

KEGG: hsa:1293

STRING: 9606.ENSP00000295550

UniGene: Hs.233240

Pathway PI3K-Akt signaling pathway
Focal adhesion

Related Products

COL6A3 Antibodies

COL6A3 Antibodies for Homo sapiens (Human)

COL6A3 Proteins

COL6A3 Proteins for Homo sapiens (Human)

COL6A3 ELISA Kit

COL6A3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.