Recombinant Human E3 ubiquitin-protein ligase RNF5 (RNF5)

In Stock
Code CSB-CF857879HU
Abbreviation Recombinant Human RNF5 protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transferase
Alternative Names
RNF5; G16; NG2; RMA1; E3 ubiquitin-protein ligase RNF5; Protein G16; RING finger protein 5; RING-type E3 ubiquitin transferase RNF5; Ram1 homolog; HsRma1
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
2-180aa
Target Protein Sequence
AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant HumanRNF5 protein is an in vitro E.coli (cell-free) expressed protein (Full Length of Mature Protein). Its purity is 85%+ determined by SDS-PAGE. Cell-free protein expression is the in vitro synthesis of a protein using translation-compatible extracts of whole cells. In principle, whole-cell extracts contain all the macromolecules and components needed for transcription, translation, and even post-translational modification. These components include RNA polymerase, regulatory protein factors, transcription factors, ribosomes, and tRNA. When supplemented with cofactors, nucleotides, and the specific gene template, these extracts can synthesize proteins of interest in a few hours.

RNF5 is an endoplasmic reticulum (ER)-related E3 ubiquitin ligase that constitutes the UBC6e-p97 complex, which is involved in ER-associated degradation (ERAD). RNF5 can recognize misfolded proteins and facilitate their ubiquitination and proteasomal degradation. It is involved in the inflammatory response in viral infections through the ubiquitination of transmembrane protein 173 as well as suppression of the activation of virus-induced interferon regulatory factor 3, expression of interferon beta 1, and the cellular antiviral response. RNF5 is upregulated in several cancers, including breast cancer, hepatocellular carcinoma, and acute myeloid leukemia (AML). Inhibition of RNF5 expression reduces proliferation of breast cancer cells.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has E2-dependent E3 ubiquitin-protein ligase activity. May function together with E2 ubiquitin-conjugating enzymes UBE2D1/UBCH5A and UBE2D2/UBC4. Mediates ubiquitination of PXN/paxillin and Salmonella type III secreted protein sopA. May be involved in regulation of cell motility and localization of PXN/paxillin. Mediates the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD; the ubiquitination appears to involve E2 ubiquitin-conjugating enzyme UBE2N. Mediates the 'Lys-48'-linked polyubiquitination of STING1 at 'Lys-150' leading to its proteasomal degradation; the ubiquitination occurs in mitochondria after viral transfection and regulates antiviral responses.
Gene References into Functions
  1. we found that RNF5 is differentially expressed in human bronchial epithelia from CF vs. control patients. Our results identify RNF5 as a target for therapeutic modalities to antagonize mutant CFTR proteins. PMID: 26183966
  2. RNF5 is involved in the regulation of the L-glutamine carrier proteins SLC1A5 and SLC38A2. PMID: 25759021
  3. Our data suggest that RNF5 regulates the turnover of specific G protein-coupled receptors by ubiquitinating JAMP and preventing proteasome recruitment. PMID: 23798571
  4. In addition to confirming one of the top findings in the meta-analysis, TRIM26, RNF5 and HLA-DRB3 have been identified as potential candidate genes for schizophrenia. PMID: 22433715
  5. Rma1, an E3 ubiquitin ligase localized in the ER membrane, is involved in Pendrin degradation PMID: 22750442
  6. JB12 cooperates with cytosolic Hsc70 and the ubiquitin ligase RMA1 to target CFTR and CFTRDeltaF508 for degradation. PMID: 21148293
  7. found in cerebral microvessels endothelium PMID: 11603805
  8. RNF5 regulates cell motility by targeting paxillin ubiquitination and altered localization PMID: 12861019
  9. the G(16)-mediated activation of IKK/NFkappaB by N(6)-cyclohexyladenosine requires a complex signaling network composed of multiple intermediates PMID: 15485865
  10. efficient bacterial escape into the cytosol of epithelial cells requires HsRMA1-mediated SopA ubiquitination and contributes to Salmonella-induced enteropathogenicity PMID: 16176924
  11. RNF5 is a novel regulator of breast cancer progression through its effect on actin cytoskeletal alterations. PMID: 17804730
  12. RNF5 associates with JAMP in the ER membrane. This association results in Ubc13-dependent RNF5-mediated noncanonical ubiquitination of JAMP. PMID: 19269966
  13. E3 ubiquitin ligase RNF5 interacted with MITA in a viral-infection-dependent manner PMID: 19285439

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein. Mitochondrion membrane. Endoplasmic reticulum membrane. Note=Predominantly located in the plasma membrane, with some localization occurring within cytoplasmic organelles.
Tissue Specificity
Widely expressed.
Database Links

HGNC: 10068

OMIM: 602677

KEGG: hsa:6048

STRING: 9606.ENSP00000364235

UniGene: Hs.731774

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*