Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

RNF5

Uniprot No.

Q99942

Research Area

Transferase

Alternative Names

RNF5; G16; NG2; RMA1; E3 ubiquitin-protein ligase RNF5; Protein G16; RING finger protein 5; RING-type E3 ubiquitin transferase RNF5; Ram1 homolog; HsRma1

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

2-180aa

Target Protein Sequence

AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

25.8 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

18-23 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This recombinant HumanRNF5 protein is an in vitro E.coli (cell-free) expressed protein (Full Length of Mature Protein). Its purity is 85%+ determined by SDS-PAGE. Cell-free protein expression is the in vitro synthesis of a protein using translation-compatible extracts of whole cells. In principle, whole-cell extracts contain all the macromolecules and components needed for transcription, translation, and even post-translational modification. These components include RNA polymerase, regulatory protein factors, transcription factors, ribosomes, and tRNA. When supplemented with cofactors, nucleotides, and the specific gene template, these extracts can synthesize proteins of interest in a few hours.

RNF5 is an endoplasmic reticulum (ER)-related E3 ubiquitin ligase that constitutes the UBC6e-p97 complex, which is involved in ER-associated degradation (ERAD). RNF5 can recognize misfolded proteins and facilitate their ubiquitination and proteasomal degradation. It is involved in the inflammatory response in viral infections through the ubiquitination of transmembrane protein 173 as well as suppression of the activation of virus-induced interferon regulatory factor 3, expression of interferon beta 1, and the cellular antiviral response. RNF5 is upregulated in several cancers, including breast cancer, hepatocellular carcinoma, and acute myeloid leukemia (AML). Inhibition of RNF5 expression reduces proliferation of breast cancer cells.

Target Background

Function

Has E2-dependent E3 ubiquitin-protein ligase activity. May function together with E2 ubiquitin-conjugating enzymes UBE2D1/UBCH5A and UBE2D2/UBC4. Mediates ubiquitination of PXN/paxillin and Salmonella type III secreted protein sopA. May be involved in regulation of cell motility and localization of PXN/paxillin. Mediates the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD; the ubiquitination appears to involve E2 ubiquitin-conjugating enzyme UBE2N. Mediates the 'Lys-48'-linked polyubiquitination of STING1 at 'Lys-150' leading to its proteasomal degradation; the ubiquitination occurs in mitochondria after viral transfection and regulates antiviral responses.

Gene References into Functions

we found that RNF5 is differentially expressed in human bronchial epithelia from CF vs. control patients. Our results identify RNF5 as a target for therapeutic modalities to antagonize mutant CFTR proteins. PMID: 26183966
RNF5 is involved in the regulation of the L-glutamine carrier proteins SLC1A5 and SLC38A2. PMID: 25759021
Our data suggest that RNF5 regulates the turnover of specific G protein-coupled receptors by ubiquitinating JAMP and preventing proteasome recruitment. PMID: 23798571
In addition to confirming one of the top findings in the meta-analysis, TRIM26, RNF5 and HLA-DRB3 have been identified as potential candidate genes for schizophrenia. PMID: 22433715
Rma1, an E3 ubiquitin ligase localized in the ER membrane, is involved in Pendrin degradation PMID: 22750442
JB12 cooperates with cytosolic Hsc70 and the ubiquitin ligase RMA1 to target CFTR and CFTRDeltaF508 for degradation. PMID: 21148293
found in cerebral microvessels endothelium PMID: 11603805
RNF5 regulates cell motility by targeting paxillin ubiquitination and altered localization PMID: 12861019
the G(16)-mediated activation of IKK/NFkappaB by N(6)-cyclohexyladenosine requires a complex signaling network composed of multiple intermediates PMID: 15485865
efficient bacterial escape into the cytosol of epithelial cells requires HsRMA1-mediated SopA ubiquitination and contributes to Salmonella-induced enteropathogenicity PMID: 16176924
RNF5 is a novel regulator of breast cancer progression through its effect on actin cytoskeletal alterations. PMID: 17804730
RNF5 associates with JAMP in the ER membrane. This association results in Ubc13-dependent RNF5-mediated noncanonical ubiquitination of JAMP. PMID: 19269966
E3 ubiquitin ligase RNF5 interacted with MITA in a viral-infection-dependent manner PMID: 19285439

Hide All

Subcellular Location

Membrane; Multi-pass membrane protein. Mitochondrion membrane. Endoplasmic reticulum membrane. Note=Predominantly located in the plasma membrane, with some localization occurring within cytoplasmic organelles.

Tissue Specificity

Widely expressed.

Database Links

HGNC: 10068

OMIM: 602677

KEGG: hsa:6048

STRING: 9606.ENSP00000364235

UniGene: Hs.731774

Code	CSB-CF857879HU
Abbreviation	Recombinant Human RNF5 protein
MSDS	MSDS Datasheet
Size	$1620
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human E3 ubiquitin-protein ligase RNF5 (RNF5)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage