Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Transferase
Alternative Names
RNF5; G16; NG2; RMA1; E3 ubiquitin-protein ligase RNF5; Protein G16; RING finger protein 5; RING-type E3 ubiquitin transferase RNF5; Ram1 homolog; HsRma1
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
2-180aa
Target Protein Sequence
AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
18-23 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This recombinant HumanRNF5 protein is an in vitro E.coli (cell-free) expressed protein (Full Length of Mature Protein). Its purity is 85%+ determined by SDS-PAGE. Cell-free protein expression is the in vitro synthesis of a protein using translation-compatible extracts of whole cells. In principle, whole-cell extracts contain all the macromolecules and components needed for transcription, translation, and even post-translational modification. These components include RNA polymerase, regulatory protein factors, transcription factors, ribosomes, and tRNA. When supplemented with cofactors, nucleotides, and the specific gene template, these extracts can synthesize proteins of interest in a few hours.
RNF5 is an endoplasmic reticulum (ER)-related E3 ubiquitin ligase that constitutes the UBC6e-p97 complex, which is involved in ER-associated degradation (ERAD). RNF5 can recognize misfolded proteins and facilitate their ubiquitination and proteasomal degradation. It is involved in the inflammatory response in viral infections through the ubiquitination of transmembrane protein 173 as well as suppression of the activation of virus-induced interferon regulatory factor 3, expression of interferon beta 1, and the cellular antiviral response. RNF5 is upregulated in several cancers, including breast cancer, hepatocellular carcinoma, and acute myeloid leukemia (AML). Inhibition of RNF5 expression reduces proliferation of breast cancer cells.
