Recombinant Human ER lumen protein retaining receptor 2(KDELR2)

Code CSB-CF012130HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P33947
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYN TSMKVIYLACSYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILW TFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIA VVAGVVQTILYCDFFYLYITKVLKGKKLSLPA
Source in vitro E.coli expression system
Gene Names KDELR2
Protein Names Recommended name: ER lumen protein retaining receptor 2 Alternative name(s): ERD2-like protein 1 Short name= ELP-1 KDEL endoplasmic reticulum protein retention receptor 2 Short name= KDEL receptor 2
Expression Region 1-212
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families ERD2 family
Database Links

HGNC: 6305

OMIM: 609024

KEGG: hsa:11014

STRING: 9606.ENSP00000258739

UniGene: Hs.654552

Related Products

KDELR2 Antibodies

KDELR2 Antibodies for Homo sapiens (Human)

KDELR2 Proteins

KDELR2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.