Recombinant Human Epithelial membrane protein 2 (EMP2)

Code CSB-CF007649HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
EMP2
Uniprot No.
Alternative Names
EMP2; XMP; Epithelial membrane protein 2; EMP-2; Protein XMP
Species
Homo sapiens (Human)
Expression Region
1-167
Target Protein Sequence
MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST LQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRR EDIHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as a key regulator of cell membrane composition by regulating proteins surface expression. Also, plays a role in regulation of processes including cell migration, cell proliferation, cell contraction and cell adhesion. Negatively regulates caveolae formation by reducing CAV1 expression and CAV1 amount by increasing lysosomal degradation. Facilitates surface trafficking and formation of lipid rafts bearing GPI-anchor proteins. Regulates surface expression of MHC1 and ICAM1 proteins increasing susceptibility to T-cell mediated cytotoxicity. Regulates the plasma membrane expression of the integrin heterodimers ITGA6-ITGB1, ITGA5-ITGB3 and ITGA5-ITGB1 resulting in modulation of cell-matrix adhesion. Also regulates many processes through PTK2. Regulates blood vessel endothelial cell migration and angiogenesis by regulating VEGF protein expression through PTK2 activation. Regulates cell migration and cell contraction through PTK2 and SRC activation. Regulates focal adhesion density, F-actin conformation and cell adhesion capacity through interaction with PTK2. Positively regulates cell proliferation. Plays a role during cell death and cell blebbing. Promotes angiogenesis and vasculogenesis through induction of VEGFA via a HIF1A-dependent pathway. Also plays a role in embryo implantation by regulating surface trafficking of integrin heterodimer ITGA5-ITGB3. May play a role in glomerular filtration.
Gene References into Functions
  1. It is a biomarker in gliomas and may have use as a molecular target for the diagnosis and treatment of gliomas. PMID: 28887715
  2. High EMP2 expression is associated with endometrial cancer. PMID: 28604744
  3. Experiments in vitro using human trophoblast cells lines indicate that EMP2 modulates angiogenesis by altering HIF-1alpha expression. The results reveal a novel role for EMP2 in regulating trophoblast function and vascular development in mice and humans, and suggest that it may be a new biomarker for placental insufficiency. PMID: 28295343
  4. All studied ERMs and PVR membranes express EMP2. Levels of EMP2 trended higher in all PVR subgroups than in ERMs, especially in inflammatory and traumatic PVR. PMID: 27294805
  5. a novel SNP x SNP interaction between rs2267668 in PPARdelta and rs7191411 in EMP2 that has significant impact on circulating HDL-C levels in the Singaporean Chinese population. PMID: 27530449
  6. These results support that loss of EMP2 is common, and its re-expression may serve as an approach to enhance radiation sensitivity in nasopharyngeal carcinoma. PMID: 28347228
  7. Data show that loss of epithelial membrane protein 2 (EMP2) is involved in sphingosylphosphorylcholine (SPC)-induced phosphorylation of keratin 8 (K8) via ubiquitination of protein phosphatase 2 (PP2A) through alpha4 phosphoprotein by caveolin-1 (cav-1). PMID: 26876307
  8. EMP2 plays a tumor suppressor role by inducing G2/M cell cycle arrest, suppressing cell viability, proliferation, colony formation/ anchorage-independent cell growth via regulation of G2/M checkpoints in distinct-derived cell lines. PMID: 25940704
  9. Loss of EMP2 is associated with nasopharyngeal carcinoma. PMID: 25684502
  10. the role of EMP2 in the pathogenesis of GBM a PMID: 24644285
  11. We showed that knockdown of EMP2 in podocytes and endothelial cells resulted in an increased amount of CAVEOLIN-1 and decreased cell proliferation, so EMP2 mutations causes a recessive Mendelian form of steroid-sensitive nephrotic syndrome. PMID: 24814193
  12. EMP2 was identified as a tumor-suppressor gene in urinary tract urothelial carcinoma. PMID: 23838430
  13. support the role of EMP2 in the control of the tumor microenvironment and confirm the cytotoxic effects observed by EMP2 treatment in vivo PMID: 23334331
  14. Manipulation of EMP2 levels in endometrial cancer cells regulates the phosphorylation of FAK and Src, and promotes their distribution into lipid raft domains. PMID: 21637765
  15. EMP2 is expressed in the majority of ovarian tumors and may be a feasible target in vivo. PMID: 20670949
  16. evaluation as candidate gene for Charcot-Marie-Tooth disease type 1C on chromosome 16p PMID: 11713717
  17. This protein is expressed in discrete anatomical regions of the eye. PMID: 12710941
  18. EMP2 induces alphavbeta3 surface expression. PMID: 16216233
  19. These findings identify EMP2 as a candidate host protein involved in infection of Chlamydia muridarum. [EMP-2] PMID: 17544801
  20. EMP2 regulates caveolin-1 transcription and more substantially its protein levels. PMID: 17609206
  21. Targeting of EMP2 to specific locations under the influence of these steroid hormones may be important for integrating the molecular responses required for implantation competence. PMID: 18400107
  22. EMP2 may be a potential pharmacologic target for human endometrial cancer. PMID: 19010852

Show More

Hide All

Involvement in disease
Nephrotic syndrome 10 (NPHS10)
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane. Apical cell membrane. Membrane raft. Cytoplasm. Nucleus.
Protein Families
PMP-22/EMP/MP20 family
Tissue Specificity
Expressed in ciliary body epithelia, sclera, cornea, and retinal pigment epithelium (at protein level).
Database Links

HGNC: 3334

OMIM: 602334

KEGG: hsa:2013

STRING: 9606.ENSP00000352540

UniGene: Hs.531561

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1