Recombinant Human Estradiol 17-beta-dehydrogenase 2(HSD17B2)

Code CSB-CF010772HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P37059
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT
Source in vitro E.coli expression system
Gene Names HSD17B2
Protein Names Recommended name: Estradiol 17-beta-dehydrogenase 2 EC= 1.1.1.62 Alternative name(s): 17-beta-hydroxysteroid dehydrogenase type 2 Short name= 17-beta-HSD 2 20 alpha-hydroxysteroid dehydrogenase Short name= 20-alpha-HSD E2DH Microsomal 1
Expression Region 1-387
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH.
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Database Links

HGNC: 5211

OMIM: 109685

KEGG: hsa:3294

STRING: 9606.ENSP00000199936

UniGene: Hs.162795

Related Products

HSD17B2 Antibodies

HSD17B2 Antibodies for Homo sapiens (Human)

HSD17B2 Antibodies for Human

HSD17B2 Proteins

HSD17B2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.