Recombinant Human Free fatty acid receptor 3(FFAR3)

Code CSB-CF008606HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O14843
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTAS DLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHP LWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAI LLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGP YNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQ WQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES
Source in vitro E.coli expression system
Gene Names FFAR3
Protein Names Recommended name: Free fatty acid receptor 3 Alternative name(s): G-protein coupled receptor 41
Expression Region 1-346
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function G protein-coupled receptor that is activated by a major product of dietary fiber digestion, the short chain fatty acids (SCFAs), and that plays a role in the regulation of whole-body energy homeostasis and in intestinal immunity. In omnivorous mammals, the short chain fatty acids acetate, propionate and butyrate are produced primarily by the gut microbiome that metabolizes dietary fibers. SCFAs serve as a source of energy but also act as signaling molecules. That G protein-coupled receptor is probably coupled to the pertussis toxin-sensitive, G(i/o)-alpha family of G proteins. Its activation results in the formation of inositol 1,4,5-trisphosphate, the mobilization of intracellular calcium, the phosphorylation of the MAPK3/ERK1 and MAPK1/ERK2 kinases and the inhibition of intracellular cAMP accumulation
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Highest level in adipose tissue, and lower expression across all tissues tested. Expressed in sympathetic ganglia.
Database Links

HGNC: 4499

OMIM: 603821

KEGG: hsa:2865

STRING: 9606.ENSP00000328230

UniGene: Hs.248055

Related Products

FFAR3 Antibodies

FFAR3 Antibodies for Homo sapiens (Human)

FFAR3 Antibodies for Human

FFAR3 Proteins

FFAR3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.