Recombinant Human G protein-activated inward rectifier potassium channel 2 (KCNJ6)

Code CSB-CF012059HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
KCNJ6; GIRK2; KATP2; KCNJ7; G protein-activated inward rectifier potassium channel 2; GIRK-2; BIR1; Inward rectifier K(+ channel Kir3.2; KATP-2; Potassium channel, inwardly rectifying subfamily J member 6
Species
Homo sapiens (Human)
Expression Region
1-423
Target Protein Sequence
MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKD GKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGD MDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSI VNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAK LIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKE ELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYET STPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENE SKV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This potassium channel may be involved in the regulation of insulin secretion by glucose and/or neurotransmitters acting through G-protein-coupled receptors. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.
Gene References into Functions
  1. The KCNJ6 -1250A and COMT Val alleles are predisposing preterm newborns to diminished opioid-induced pain relief. PMID: 27027462
  2. The major findings of the current study are 1) an additive genotypic effect of the KCNJ6 SNP on the ERO theta power phenotype during reward processing, increasing significantly across genotypes. PMID: 27993610
  3. Three of the four KCNJ6 SNPs studied here were found to be significantly associated with the same theta event related oscillations in adults. PMID: 27847216
  4. The findings of this study suggest that variations in KCNJ6 genes are associated with both mild and severe persistent breast pain after breast cancer surgery. PMID: 25599232
  5. KCNJ6 (GIRK2) gene polymorphism rs2835859 could serve as a marker that predicts sensitivity to analgesics and pain and susceptibility to nicotine dependence. PMID: 25346042
  6. In this transgenic mouse model, GIRK2 plays a major role in the genesis of infantile spasms. PMID: 26032891
  7. Keppen-Lubinsky syndrome is caused by mutations in the inwardly rectifying K+ channel encoded by KCNJ6. PMID: 25620207
  8. For KCNJ6, three SNPs (i.e., rs2835914, rs8129919, rs2836050) were associated with the occurrence of preoperative breast pain. PMID: 24392765
  9. Eight KCNNJ6 single nucleotide polymorphisms(SNPs) are significantly associated with pain-related phenotypes. PMID: 23994450
  10. Ethanol associates directly with the GIRK channel, leading to enhanced interaction with a membrane phospholipid phosphatidylinositol 4,5-bisphosphate and activation of the channel. PMID: 24145411
  11. 3.5 A resolution crystal structure of the mammalian GIRK2 channel in complex with betagamma G-protein subunits, the central signalling complex that links G-protein-coupled receptor stimulation to K(+) channel activity PMID: 23739333
  12. KCNJ6 (or its product GIRK2) accounts for some of the variations in frontal theta; band oscillations. PMID: 22554406
  13. Conformational information encoded by ligand binding to delta-opioid receptors (DORs) is transmitted to Kir3.1/Kir3.2 channels. PMID: 23175530
  14. GIRK2 is expressed in nearly every human pigmented neuron or mouse tyrosine hydroxylase-immunoreactive neuron in both the substantia nigra and ventral tegmental areas. PMID: 22252428
  15. GIRK overexpression in Ts65Dn mice has functional consequences affecting balance between GABA(A) and GABA(B) inhibition of CA1 pyramidal neurons in a pathway specific manner, that may contribute to cognitive deficits in Ts65 mouse model of Down syndrome. PMID: 22178330
  16. KCNJ6 is associated with alcohol dependence and may moderate the effect of early psychosocial stress on risky alcohol drinking in adolescents PMID: 21307845
  17. The KCNJ6 promoter is activated by Trichostatin A (TSA) treatment and by serum depletion according to promoter reporter assays in HEK 293 cells. PMID: 20494980
  18. significant interaction between the TT genotype of rs2070995 (located in KCNJ6) and the GG genotype of rs2253206 (located in CREB1) on rumination were found PMID: 20943350
  19. The overexpression of one particular gene encoding for G-protein-activated inward rectifying potassium type 2 (GIRK2) channel subunit and its coupling to GABA(B) receptors may contribute to a range of mental and functional disabilities in Down syndrome. PMID: 20655490
  20. KCNJ6 (GIRK2) gene polymorphisms have roles in postoperative analgesic requirements after major abdominal surgery PMID: 19756153
  21. L344 and G347 play an important functional role in G(betagamma) activation of GIRK2 channels. PMID: 14724209
  22. The potential synergy and consequences of the overexpression of KIR3.2 and KIR4.2 in Down's syndrome brain development are discussed. PMID: 15068243
  23. Decreased GRK 2 expression most likely results from reduced cAMP stimulation in cold thyroid nodules. PMID: 15772902
  24. These data suggest that KCNJ6 could play an important role in altered cardiac regulation in Down syndrome patients. PMID: 18303085
  25. Kir3.2 was capable of interacting with Gbeta1-3 and not Gbeta4 or Gbeta5. These interactions were again fostered by co-expression with Ggamma and were also insensitive to DN Sar 1 or Rab 1. PMID: 19135528

Show More

Hide All

Involvement in disease
Keppen-Lubinsky syndrome (KPLBS)
Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ6 subfamily
Tissue Specificity
Most abundant in cerebellum, and to a lesser degree in islets and exocrine pancreas.
Database Links

HGNC: 6267

OMIM: 600877

KEGG: hsa:3763

STRING: 9606.ENSP00000288309

UniGene: Hs.626242

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1