Recombinant Human G-protein coupled receptor family C group 5 member B(GPRC5B)

Code CSB-CF868367HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9NZH0
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence ENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALITLLLMLILLVRLPFIKEKE KKSPVGLHFLFLLGTLGLFGLTFAFIIQEDETICSVRRFLWGVLFALCFSCLLSQAWRVR RLVRHGTGPAGWQLVGLALCLMLVQVIIAVEWLVLTVLRDTRPACAYEPMDFVMALIYDM VLLVVTLGLALFTLCGKFKRWKLNGAFLLITAFLSVLIWVAWMTMYLFGNVKLQQGDAWN DPTLAITLAASGWVFVIFHAIPEIHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPR AYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGG TIPTAPPSHTGRHLW
Source in vitro E.coli expression system
Gene Names GPRC5B
Protein Names Recommended name: G-protein coupled receptor family C group 5 member B Alternative name(s): A-69G12.1 Retinoic acid-induced gene 2 protein Short name= RAIG-2
Expression Region 29-403
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Unknown. This retinoic acid-inducible G-protein coupled receptor provide evidence for a possible interaction between retinoid and G-protein signaling pathways.
Subcellular Location Cell membrane, Multi-pass membrane protein, Cytoplasmic vesicle membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 3 family
Tissue Specificity Expression is high in kidney, pancreas, and testis, medium in brain, heart, prostate, small intestine, and spleen, low in liver, placenta, skeletal muscle, colon, ovary, and thymus, and not detectable in lung and peripheral leukocyte. According to PubMed:
Database Links

HGNC: 13308

OMIM: 605948

KEGG: hsa:51704

UniGene: Hs.148685

Related Products

GPRC5B Antibodies

GPRC5B Antibodies for Homo sapiens (Human)

GPRC5B Proteins

GPRC5B Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.