Recombinant Human Growth hormone secretagogue receptor type 1 (GHSR)

Code CSB-CF842164HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
GHSR; Growth hormone secretagogue receptor type 1; GHS-R; GH-releasing peptide receptor; GHRP; Ghrelin receptor
Species
Homo sapiens (Human)
Expression Region
1-366
Target Protein Sequence
MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT ESSINT
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for ghrelin, coupled to G-alpha-11 proteins. Stimulates growth hormone secretion. Binds also other growth hormone releasing peptides (GHRP) (e.g. Met-enkephalin and GHRP-6) as well as non-peptide, low molecular weight secretagogues (e.g. L-692,429, MK-0677, adenosine).
Gene References into Functions
  1. Ghrelin acts through the growth hormone secretagogue-receptor (GHS-R), a seven transmembrane G protein-coupled receptor with high expression in the anterior pituitary, pancreatic islets, thyroid gland, heart and various regions of the brain. PMID: 29412824
  2. Expression of ghrelin and GHSR1a was studied in human pituitary adenomas. PMID: 28377557
  3. The expression, functional reconstitution and first NMR characterization of the human growth hormone secretagogue (GHS) receptor reconstituted into bilayer membranes is described. PMID: 28387359
  4. GHSR gene polymorphism is associated with ghrelin sensitivity, suggesting that this gene can explain the connection between stunting in childhood and obesity in adulthood [review] PMID: 29950536
  5. GHS-R1a expression in periodontal cells challenged with the periodontopathogen Fusobacterium nucleatum, in gingival biopsies from periodontally healthy and diseased individuals, was analyzed by real-time PCR, immunocytochemistry, and immunofluorescence. PMID: 29317796
  6. association to the purified GHSR:D2R heteromer triggers a different active conformation of Galphai that is linked to a higher rate of GTP binding and a faster dissociation from the heteromeric receptor. PMID: 29632174
  7. By unbiased genome-wide DNA methylation profiling and comprehensive stepwise verification and validation studies using in vitro and patient-derived samples, we identified 3 promising methylation markers (GHSR, SST, and ZIC1) associated with a 3q gain for the detection of cervical (pre)cancer PMID: 28119363
  8. Ghrelin concentrations significantly decreased from pregnancy to 6 weeks postpartum and this change differed based on pregnancy depression status. Finally, ghrelin levels were lower in women who breastfed compared with women who were bottle-feeding. PMID: 26424410
  9. it showed that the antinociception of ghrelin was correlated with the GHS-R1alpha and d-opioid receptors. Finally, the antinociception induced by deltorphin II wasn't blocked by the co-injection (i.c.v.) of [D-Lys(3)]-GHRP-6, indicating that the GHS-R1a isn't on the backward position of delta opioid receptor. PMID: 27474249
  10. our results showed for the first time that the downregulation of GHSR1a by shRNA technology inhibits the growth of colorectal cancer cell line and xenograft tumor through upregulation of PTEN at transcription as well as translation levels. PMID: 27464938
  11. GHSR mutations are associated with Obesity. PMID: 27288828
  12. GHS-R1 protein in placenta was not differentially expressed among infants, small, adequate or large for gestational age. PMID: 26754660
  13. Results indicate that neuronal GHS-R is a crucial regulator of energy metabolism and a key mediator of DIO. Neuronal Ghsr deletion protects against DIO by regulating energy expenditure, not by energy intake. These novel findings suggest that suppressing central ghrelin signaling may serve as a unique antiobesity strategy. PMID: 27207529
  14. data is consistent with the hypothesis that the phosphorylation pattern on the C terminus of GHSR1a determines the signaling and physiological output. PMID: 26935831
  15. Results suggest that the minor allele of the rs2948694 in the GHSR gene was associated with increased smoking possibly reflects an association with alcohol use disorder and nicotine dependence. PMID: 26059200
  16. GHS-R1b not only determines the efficacy of ghrelin-induced GHS-R1a-mediated signaling but also determines the ability of GHS-R1a to form oligomeric complexes with other receptors. PMID: 27129257
  17. Study demonstrates that the GHS-R1a/5-HT2C receptor interaction translates into a biologically significant modulation of ghrelin's orexigenic effect PMID: 25727097
  18. The data indicates that GHSR hypermethylation is a pan-cancer marker regardless of the tissue from which the tumor originates. PMID: 25603164
  19. the single nucleotide polymorphism of GHSR might be weaker association with cancer risk, especially with breast cancer risk PMID: 25524946
  20. Data (including data from knockout mice) suggest ghrelin produced in pancreatic islets regulates insulin secretion and thereby regulates blood glucose; ghrelin signaling via growth hormone secretagogue-receptor appears to be involved. [REVIEW] PMID: 25200304
  21. This study suggests that the rs696217 and rs2075356 ghrelin gene (GHRL) polymorphisms may protect carriers against breast cancer, and the rs4684677 GHRL and rs572169 GHSR polymorphisms may increase the risk among carriers.[Meta-analysis] PMID: 25376984
  22. The Ghr and GHSR-1a were co-expressed by the pigmented epithelium (PE) of the CB, by the retinal pigmented epithelium (RPE) and by the anterior limiting layer (ALL) of the iris. PMID: 24809812
  23. Data indicate that activation of growth hormone secretagogue receptor (GHSR) may trigger a diversity of signaling mechanisms and subsequent distinct physiological responses. PMID: 24651458
  24. findings suggest an avenue for modulating drug abuse-associated changes in synaptic plasticity via GHSR1a and indicate the development of GHSR1a-biased ligands as a promising strategy for selectively targeting downstream signaling events. PMID: 25261469
  25. Immunohistochemical staining revealed expression of ghrelin and GHSR1alpha both in glandular endometrioid epithelium and in some stromal cells, particularly in some fibroblasts, blood vessels and infiltrating leukocytes. PMID: 22087538
  26. Ghrelin induces cell proliferation, migration and invasion via GHS-R/NF-kappaB signaling pathway in gastric cancer cells. PMID: 23807739
  27. We found that ghrelin and GHSR1a are expressed in ovarian epithelial carcinoma in vivo and in vitro. Ghrelin inhibits the proliferation and growth of HO-8910 cells by G1 phase arrest. PMID: 23982275
  28. GHSROS, which is expressed in lung cancer and stimulates cell migration in lung cancer cell lines, contributes to the growing number of non-coding RNAs that play a role in the regulation of tumourigenesis and metastatic cancer progression. PMID: 23722988
  29. In the posterior segment, the ghrelin-GHSR-1a system interferes with the development of oxygen-induced retinopathy, being protective in the vaso-obliterative phase and deleterious in the vaso-proliferative stage of the disease. (Review) PMID: 23816797
  30. Studies suggest that dysregulation in the components of the ghrelin system including ghrelin, ghrelin receptor (GHSR1a) and ghrelin-O-acyl-transferase can lead to or influence the development and/or progression of highly concerning pathologies. PMID: 24194510
  31. Ghrelin and NUCB2/nesfatin-1 are expressed in the same gastric cell and differentially correlated with body mass index in obese subjects. PMID: 23515787
  32. Heterodimerization with Its splice variant blocks the ghrelin receptor 1a in a non-signaling conformation: a study with a purified heterodimer assembled into lipid discs. PMID: 23839942
  33. Ghrelin alone or in combination with TNF-alpha may prove to be a novel indicator of coronary atherosclerosis. PMID: 23079033
  34. Ghrelin/growth hormone secretagogue receptor signaling plays biologically/clinically relevant roles by influencing energy metabolism, growth hormone secretion, inflammatory responses, cardiovascular performance, and behavior. [REVIEW] PMID: 22632856
  35. Deregulation of ghrelin/ghrelin receptor signaling can lead to either development of obesity or anorexia nervosa. [REVIEW] PMID: 22632858
  36. a link between epigenetic down-regulation of GHSR and breast cancer cell invasion PMID: 22899222
  37. Promiscuous dimerization of the growth hormone secretagogue receptor (GHS-R1a) attenuates ghrelin-mediated signaling PMID: 23161547
  38. data suggested that in species expressing both motilin-MR and ghrelin-GHSR, there is a compensatory relationship in vivo PMID: 22465164
  39. high constitutive activity of the ghrelin receptor is dependent upon flexibility in the C-terminal segment of extracellular loop 2 PMID: 22846991
  40. association analysis between genotypes for SNPs rs9819506 and rs490683 of the GHSR gene promoter and weight loss following Roux-en-Y gastric bypass surgery; role of increased ghrelin levels in weight loss outcomes following RYGB surgery may be influenced by variation in the GHSR gene PMID: 22411573
  41. Interaction of the melanocortin 3 receptor (MC3R) and the growth hormone secretagogue receptor (GHSR)-1a results in a modulation of function in both receptors. PMID: 22327910
  42. Despite the major role of ghrelin in growth and appetite regulation, our results indicate that mutations in ghrelin and GHSR do not explain short stature and weight regulation disorders in children in our population. PMID: 22876551
  43. Using the ghrelin receptor reconstituted as a monomer into lipid discs and labeled with a fluorescent conformational reporter, we demonstrate that ligand efficacy and functional selectivity are directly related to different receptor conformations. PMID: 22573814
  44. Longitudinal study between birth & 10 years in a popul-based cohort revealed a significant association of the rs482204 and rs562416 GHSR polymorphisms on height, whereas no association between GHSR polymorphisms and weight or BMI was ascertainable PMID: 22457237
  45. Examined the effects of exercise on ghrelin plasma concentrations in children. The study showed a correlation between the proportional increase of acylated ghrelin and the duration of exercise. PMID: 20636306
  46. The studies do not support the hypothesis of GHSR polymorphisms being significant contributors of obesity risk, Type 2 Diabetes mellitus risk, eating disorders, or height determination. (Review) PMID: 21930173
  47. The distinct ligand requirements for the interaction of purified GHS-R1a with arrestin and AP2 provide a new rationale to the differences in basal and agonist-induced internalization observed in cells. PMID: 22117076
  48. ghrelin receptors can be retained in the endoplasmic reticulum by heterodimerization with GHS-R1b, and constitutive activation of phospholipase C is attenuated due to decreased cell surface expression of ghrelin receptors PMID: 21903149
  49. Ghrelin receptors are expressed by distal tubules of the mouse kidney. PMID: 21956643
  50. An association of a haplotype in the GHSR gene with multiple sclerosis was found in one patient cohort, but it could not be replicated in a second patient cohort. PMID: 21664965

Show More

Hide All

Involvement in disease
Growth hormone deficiency, isolated partial (GHDP)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Pituitary and hypothalamus.
Database Links

HGNC: 4267

OMIM: 601898

KEGG: hsa:2693

STRING: 9606.ENSP00000241256

UniGene: Hs.130212

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1