Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (MS4A2)

In Stock
Code CSB-CF015013HU
Abbreviation Recombinant Human MS4A2 protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-244aa
Target Protein Sequence
MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.6 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
High affinity receptor that binds to the Fc region of immunoglobulins epsilon. Aggregation of FCER1 by multivalent antigens is required for the full mast cell response, including the release of preformed mediators (such as histamine) by degranulation and de novo production of lipid mediators and cytokines. Also mediates the secretion of important lymphokines. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators responsible for the manifestations of allergy.
Gene References into Functions
  1. Using immunohistochemistry, we validated that MS4A2, the beta subunit of the IgE receptor expressed on mast cells, is a favorable prognostic indicator and show that MS4A2 gene expression is an independent prognostic marker for early-stage lung cancer patient survival. PMID: 28775209
  2. in patients with allergic rhinitis without asthma, the FCER1B rs569108 and rs512555 polymorphisms are associated with increased risk of developing allergic rhinitis and with lower IgE levels. PMID: 26792385
  3. study found a difference in the frequencies of genotypes of FcvarepsilonRIbeta subunit int 2 in allergic rhinitis patients and controls. The FcvarepsilonRIbeta subunit int 2 gene polymorphism was found to be associated with allergic rhinitis in the Polish cohort PMID: 24981302
  4. MS4A2 was differentially expressed between Fibromyalgia patients and healthy controls. PMID: 27157394
  5. no association between gene polymorphism and chronic spontaneous urticaria in Kashmiri population PMID: 24953255
  6. FcepsilonRIbeta -109C/T and IFN-gamma 874T/A polymorphisms may be influencing factors for asthma in the Asian population PMID: 25530133
  7. The results explain how initial membrane interactions of clustered IgE-Fcepsilon RI complexes lead to downstream cellular responses. PMID: 25658351
  8. Data indicated that the MS4A2 gene E237G variant may be a risk factor for developing atopic asthma and the promoter -109T allele is a potential risk factor of asthma in Asians. PMID: 24495860
  9. Cytoplasmic FcepsilonRIbeta, which is not co-localized with FcepsilonRIalpha, may function as a negative regulator, as it can capture important signalling molecules such as Lyn. PMID: 24118172
  10. t-FcepsilonRIbeta mediates Ca2+ -dependent microtubule formation, which promotes degranulation and cytokine release. PMID: 23643722
  11. The interaction between Lyn and FcepsilonRIbeta is indispensable for FcepsilonRI-mediated human mast cell activation. PMID: 22845063
  12. Demethylation of specific regulatory elements within the FCER1G locus contributes to FcepsilonRI overexpression on monocytes from patients with atopic dermatitis. PMID: 22150093
  13. Polymorphisms in the Fc epsilon R1beta gene confer susceptibility to atopy in Korean children and may have a disease-modifying effect on airways in asthmatic patients. PMID: 19288130
  14. No associations with total and specific IgE levels as well as allergic sensitization were seen for FCER1B and FCER1G PMID: 20028371
  15. Methylation levels at the AluSp repeat analysed in MS4A2 were inconsistent with classical imprinting mechanisms and did not associate with atopy status PMID: 19796196
  16. Significant associations of single nucleotide polymorphisms with wheeze in the past year were detected in only four genes (IL4R, TLR4, MS4A2, TLR9). Variants in IL4R and TLR4 were also related to allergen-specific IgE, but not for MS4A2 and TLR9. PMID: 20085599
  17. Gene expression profiling after stimulation via high-affinity Fcepsilon receptor I (FcepsilonRI), showed the transcriptional levels of several CC chemokines were markedly increased. PMID: 12393595
  18. Products of the beta gene may control the level of surface expression, influencing susceptibility to allergies. PMID: 12753743
  19. The data suggested that the Gly237Gly genotype of the Fc epsilon RI beta gene conferred genetic susceptibility to allergic asthma in Chinese, which affected the total plasma IgE levels in the allergic asthma patients. PMID: 12903039
  20. A statistically significant association was foundbetween atopy and FcERIint2 variant polymorphism FcERIint2 polymorphism is related to atopy and may influence its development. PMID: 15087090
  21. The genomic region encompassing the beta-chain has been linked to atopy and a number of polymorphisms within the FcepsilonRIbeta gene are associated with various atopic diseases. PMID: 15316148
  22. FcepsilonRI beta-chain gene expression is down-regulated by a transcription factor, MZF-1, adn its cofactor FHL-3. PMID: 15453830
  23. Single nucleotide polymorphisms (SNPs) in the Fc epsilon receptor I beta promoter are causally linked with atopy via regulation of Fc epsilon RI expression. PMID: 15528387
  24. The speed of allergic symptom generation depends on the degree of IgE Fc epsilon receptor type I receptor triggering. PMID: 17088130
  25. in the Korean general population, airway hyper-responsiveness is significantly associated with the E237G polymorphism of FcepsilonRI-beta, which results in an intolerant amino acid substitution PMID: 17430357
  26. FcepsilonRIbeta E237G allele may have a protective role in wheezing illness among Taiwanese schoolchildren, depending on airway oxidative stress levels. PMID: 18269668
  27. The -237T>G polymorphism may be associated with the rate of atopy, which in turn could increase the release of histamine from basophils and may lead to the development of the aspirin-intolerant chronic urticaria PMID: 18534082
  28. PLSCR1 is a novel amplifier of FcepsilonRI signaling that acts selectively on the Lyn-initiated LAT/phospholipase Cgamma1/calcium axis, resulting in potentiation of a selected set of mast cell responses PMID: 18579528
  29. Fcgr4 is a mouse IgE receptor that resembles macrophage MS4A2 protein in humans and promotes IgE-induced lung inflammation. PMID: 18949059
  30. A promoter-dependent mechanism with altered transcriptional regulation of FcepsilonRIbeta may be involved for its association with asthma. PMID: 19218813

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
MS4A family
Tissue Specificity
Found on the surface of mast cells and basophils.
Database Links

HGNC: 7316

OMIM: 147138

KEGG: hsa:2206

STRING: 9606.ENSP00000278888

UniGene: Hs.386748

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*