Recombinant Human Hyaluronan synthase 3 (HAS3)

Code CSB-CF010142HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
HAS3
Uniprot No.
Alternative Names
HAS3; Hyaluronan synthase 3; Hyaluronate synthase 3; Hyaluronic acid synthase 3; HA synthase 3
Species
Homo sapiens (Human)
Expression Region
1-553
Target Protein Sequence
MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQS LFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVM VVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRA STFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGG VGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCVQCISGPLGMYRNSLLQQFLE DWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRWLNQQTRWSKS YFREWLYNSLWFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVG IIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSGRKTIVVNFIG LIPVSIWVAVLLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRCG KKPEQYSLAFAEV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction.
Gene References into Functions
  1. Study shows that HAS3 is induced by IL-1beta in vascular smooth muscle cells and that HAS3 is critically involved in early macrophage driven inflammation. PMID: 28987865
  2. miR-29a-3p can inhibit gastric cancer cells proliferation and metastasis by regulation HAS3 expression. These findings reveal a new mechanism by which, at least partially, miR-29a-3p may act as a candidate tumor suppressor. PMID: 29693123
  3. Hyaluronan synthase 3 (HAS3) and tumor necrosis factor-alpha (TNF-alpha) formed an inter-regulation loop to enhance tumorigenesis in oral cancer. PMID: 28107185
  4. The study describes novel regulatory mechanisms governed by UDP-sugars in hyaluronan synthesis, i.e. the intracellular trafficking and extracellular shedding of HAS3. The control mechanisms reveal the significance of these glucose metabolites in hyaluronan synthesis, which is particularly important in the interactions of malignant cells with their microenvironment, and hence the progression of tumors, like melanoma. PMID: 26883802
  5. Overexpression of HAS3 decreased ERK1/2 phosphorylation suggesting that inhibition of MAP-kinase signaling was responsible for decreased melanoma cell adhesion, migration and proliferation. PMID: 26222208
  6. HAS3 underexpression is associated with advanced tumor stage and adverse pathological features, as well as implies inferior clinical outcomes for both groups of patients with UTUCs and UBUCs, suggesting its critical role in tumor progression PMID: 25934334
  7. Hyaluronan accumulation by HAS3 favors pancreatic cancer growth. PMID: 25147816
  8. Transcriptional factor binding analysis indicated that HAS3 gene promoter lacks of canonical TATA box, but contains classical GC box as well as other putative binding sites for transcriptional factors PMID: 25843802
  9. HAS3 mRNA expression level increases in atopic dermatitis lesions compared with healthy and non-lesional skin PMID: 24658508
  10. Rab10 silencing increased the plasma membrane residence of HAS3, resulting in a significant increase of hyaluronan secretion and an enlarged cell surface HA coat, whereas Rab10 overexpression suppressed hyaluronan synthesis. PMID: 24509846
  11. Hyaluronan (HA) produced by HAS3 is a ubiquitous component of the extracellular matrix and plays an active role in tissue remodeling. In addition, HA is known to reduce reactive oxygen species (ROS) -induced cardiac injury. PMID: 24470002
  12. Nodular basal cell carcinoma is associated with increased levels of hyaluronic acid concomitant with upregulation of gene expression of HAS3, HYAL3 and RHAMM, when compared with normal adjacent skin. PMID: 20849445
  13. Data show that mRNA of HAS isoform 3 (HAS3) was upregulated in ESCC biopsies. PMID: 21429221
  14. Hyaluronan and HAS3 function in the growth and progression of colon carcinoma PMID: 14566823

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
NodC/HAS family
Database Links

HGNC: 4820

OMIM: 602428

KEGG: hsa:3038

STRING: 9606.ENSP00000304440

UniGene: Hs.592069

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1