Recombinant Human Hyaluronan synthase 3(HAS3)

Code CSB-CF010142HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O00219
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQS LFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVM VVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRA STFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGG VGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCVQCISGPLGMYRNSLLQQFLE DWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRWLNQQTRWSKS YFREWLYNSLWFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVG IIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSGRKTIVVNFIG LIPVSIWVAVLLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRCG KKPEQYSLAFAEV
Source in vitro E.coli expression system
Gene Names HAS3
Protein Names Recommended name: Hyaluronan synthase 3 EC= 2.4.1.212 Alternative name(s): Hyaluronate synthase 3 Hyaluronic acid synthase 3 Short name= HA synthase 3
Expression Region 1-553
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families NodC/HAS family
Database Links

HGNC: 4820

OMIM: 602428

KEGG: hsa:3038

STRING: 9606.ENSP00000304440

UniGene: Hs.592069

Related Products

HAS3 Antibodies

HAS3 Antibodies for Homo sapiens (Human)

HAS3 Antibodies for Human

HAS3 Proteins

HAS3 Proteins for Homo sapiens (Human)

HAS3 ELISA Kit

HAS3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.