Recombinant Human Hydroxycarboxylic acid receptor 3 (HCAR3)

Code CSB-CF343387HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
HCAR3; GPR109B; HCA3; HM74B; NIACR2; Hydroxycarboxylic acid receptor 3; G-protein coupled receptor 109B; G-protein coupled receptor HM74; G-protein coupled receptor HM74B; Niacin receptor 2; Nicotinic acid receptor 2
Species
Homo sapiens (Human)
Expression Region
1-387
Target Protein Sequence
MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWK SSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTV VAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGPANVCISF SICHTFRWHEAMFLLEFLLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVF VICFLPSVVVRIRIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPS FPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP TSNNHSKKGHCHQEPASLEKQLGCCIE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for 3-OH-octanoid acid mediates a negative feedback regulation of adipocyte lipolysis to counteract prolipolytic influences under conditions of physiological or pathological increases in beta-oxidation rates. Acts as a low affinity receptor for nicotinic acid. This pharmacological effect requires nicotinic acid doses that are much higher than those provided by a normal diet.
Gene References into Functions
  1. new insights into the G protein coupling profiles of the HCA receptors and the function of the receptor's C terminus PMID: 26656756
  2. HCA1/3 are necessary for breast cancer cells to balance lipid/fatty acid metabolism. PMID: 25839160
  3. Activated HCAR3 signals to MAP kinase cascades via the PLC-dependent PKC and MMP-mediated EGFR pathways PMID: 22289163
  4. In contrast, in a squamous cell carcinoma derived cell line, both GPR109A and GPR109B show a more diffuse cellular localization and the receptors are nearly non-functional. PMID: 21655214
  5. these results demonstrate that GPR109A and GPR109B dimerization is a constitutive process occurring early during biosynthesis. PMID: 20380810
  6. HM74 is highly expressed in adipose tissue and is a nicotinic acid receptor PMID: 12563315
  7. These results suggest that aromatic D-amino acids elicit a chemotactic response in human neutrophils via activation of GPR109B. PMID: 19237584
  8. An A allele in HM74 was significantly associated with schizophrenia and with schizophrenia plus bipolar disorder combined. PMID: 19502010
  9. the ligand receptor pair 3-OH-octanoic acid/GPR109B mediates a negative feedback regulation of adipocyte lipolysis in human but not in mouse PMID: 19561068
  10. Data show that the coordinated PPARgamma-mediated regulation of the GPR81, GPR109A and GPR109B presents a novel mechanism by which TZDs may reduce circulating free fatty acid levels and perhaps ameliorate insulin resistance in obese patients. PMID: 19633298

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expression largely restricted to adipose tissue and spleen.
Database Links

HGNC: 16824

OMIM: 606039

KEGG: hsa:8843

STRING: 9606.ENSP00000436714

UniGene: Hs.458425

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1