Recombinant Human Lymphocyte function-associated antigen 3 (CD58)

Code CSB-CF004946HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CD58
Uniprot No.
Alternative Names
CD58; LFA3; Lymphocyte function-associated antigen 3; Ag3; Surface glycoprotein LFA-3; CD antigen CD58
Species
Homo sapiens (Human)
Expression Region
29-250
Target Protein Sequence
FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells.
Gene References into Functions
  1. indicate that including both CD58 and CD81 markers in addition to CD19, CD34, CD20, CD38, and CD10 are helpful in minimal residual disease detection by flow cytometry PMID: 29500862
  2. Mutations and copy number loss of CD58 or TP53 are identified to be an independent negative prognostic factors for diffuse large B cell lymphoma. PMID: 27825110
  3. A new neuromyelitis optica spectrum disorders susceptibility variant was identified, rs56302466, on the CD58 gene, in a Han Chinese population. PMID: 28601281
  4. data suggest that loss of CD58 is a potential immune escape mechanism of HL tumor cells, especially in clinically aggressive disease PMID: 27467287
  5. Cytometry analysis evidenced a specific expression profile on reticulocytes of SCA infants, with notably an increased expression of the adhesion molecules Lu/BCAM, ICAM-4 and LFA-3, both in percentage of positive cells and in surface density. PMID: 26137540
  6. Frequent inactivating mutations of CD58 in classical Hodgkin lymphoma cell lines, but their rare occurrence in primary Hodgkin and Reed/Sternberg cells. PMID: 26194173
  7. SNPs in CD58 are associated with increased risk of candidemia. PMID: 25197941
  8. This study demonstrated that the Polymorphism, Single Nucleotide of CD58 is associated with multiple sclerosis in man in Russia. PMID: 25903733
  9. Results indicate that CD58 is a novel cell-surface marker that functionally regulates self-renewal of Colorectal tumor-initiating cells. PMID: 24727892
  10. Linkage disequilibrium show evidence that mir-548ac rs1414273 variant is strongly associated with Multiple sclerosis (MS)-associated haplotype and confirms the single nucleotide polymorphisms within the first intron of CD58 been related too. [review] PMID: 25795118
  11. The positive correlation is established between content of polymorphic nuclear monocytes and level of expression of molecules of LFA-1, ICAM-1, LFA-3, and PECAM-1. PMID: 25884075
  12. Genetic variations in CD58 were associated with the susceptibility of neuromyelitis optica in a Korean population. PMID: 24655566
  13. In 21 percent of diffuse large B cell lymphoma cases, lesions involve the CD58 gene, which encodes a molecule involved in T and natural killer cell-mediated responses PMID: 22137796
  14. Two large cohorts of systemic sclerosis (SSc) patients of European Caucasian ancestry do not support the implication of ITGAM, ITGAX, and CD58 genes in the genetic susceptibility of SSc, although they were identified as autoimmune disease risk genes. PMID: 21362770
  15. Seven selected CD58 single-nucleotide polymorphisms were found to not affect aspirin-exacerbated respiratory disease susceptibility in a Korean population. PMID: 21726122
  16. Studies indicate that SNP in IL7RA, IL2RA, CD58 and CLEC16A genes has been consistently associated with MS. PMID: 20450971
  17. Data show that coculture with activated T cells upregulated expression of CD54 and CD58 and secretion of galectin-1 by MSCs. PMID: 20570633
  18. Studies indicate that five SNPs showed genome-wide significant association with MS: HLA-DRA, IL7R, IL2RA, CD58 and CLEC16A. PMID: 19834503
  19. Signal-dependent adhesion of resting NK cells initiated by expression of ICAM-1 is greatly enhanced by coexpression of LFA-3, even in the absence of cytokines. PMID: 12496412
  20. The complement inhibitor CD59 and the lymphocyte function-associated antigen-3 (LFA-3, CD58) genes possess functional binding sites for the p53 tumor suppressor protein. PMID: 12553064
  21. Transmembrane CD58 may trigger signaling independently of the GPI-linked isoform. PMID: 15093607
  22. Human cells transformed with Ad12 demonstrated reduced expression of cell surface LFA-3. PMID: 15963548
  23. The level of CD58 molecule (in both serum and PBMC form) of patients with hepatitis B is related to the degree of liver damage. PMID: 16830383
  24. Susceptibility gene for multiple sclerosis in Australians. PMID: 18650830
  25. We found variable, but persistently elevated levels of sLFA-3 throughout the various phases and types of the hemorrhagic fever with renal syndrome, which suggest that sLFA-3 levels have correlation with disease stages. PMID: 18820826
  26. Cross-linking of CD58 induces protein tyrosine phosphorylation of BLNK, Syk and PLCgamma, and activation of ERK and Akt/PKB. PMID: 19268704
  27. Study reports additional genetic and transcriptomic evidence for the role of CD58 (LFA-3) in multiple sclerosis (MS) susceptibility using a Swedish case-control material, with a result that closely mimics that of De Jager et al. PMID: 19497873
  28. Genetic variants at CD58, is associated with rheumatoid arthritis risk PMID: 19898481

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.
Database Links

HGNC: 1688

OMIM: 153420

KEGG: hsa:965

STRING: 9606.ENSP00000358501

UniGene: Hs.34341

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1