Recombinant Human MARVEL domain-containing protein 3(MARVELD3)

Code CSB-CF842633HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q96A59
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MEDPSGAREPRARPRERDPGRRPHPDQGRTHDRPRDRPGDPRRKRSSDGNRRRDGDRDPE RDQERDGNRDRNRDRERERERERDPDRGPRRDTHRDAGPRAGEHGVWEKPRQSRTRDGAR GLTWDAAAPPGPAPWEAPEPPQPQRKGDPGRRRPESEPPSERYLPSTPRPGREEVEYYQS EAEGLLECHKCKYLCTGRACCQMLEVLLNLLILACSSVSYSSTGGYTGITSLGGIYYYQF GGAYSGFDGADGEKAQQLDVQFYQLKLPMVTVAMACSGALTALCCLFVAMGVLRVPWHCP LLLVTEGLLDMLIAGGYIPALYFYFHYLSAAYGSPVCKERQALYQSKGYSGFGCSFHGAD IGAGIFAALGIVVFALGAVLAIKGYRKVRKLKEKPAEMFEF
Source in vitro E.coli expression system
Gene Names MARVELD3
Protein Names Recommended name: MARVEL domain-containing protein 3
Expression Region 1-401
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function As a component of tight junctions, plays a role in paracellular ion conductivity.
Subcellular Location Membrane, Multi-pass membrane protein, Cell junction, tight junction
Database Links

HGNC: 30525

OMIM: 614094

KEGG: hsa:91862

UniGene: Hs.513706

Related Products

MARVELD3 Antibodies

MARVELD3 Antibodies for Homo sapiens (Human)

MARVELD3 Antibodies for Human

MARVELD3 Proteins

MARVELD3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.