Recombinant Human Melanin-concentrating hormone receptor 1 (MCHR1)

Code CSB-CF013584HU
Abbreviation Recombinant Human MCHR1 protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
G protein-coupled receptor 24;MCH-1R;SLC-1;Somatostatin receptor-like protein
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-353aa
Target Protein Sequence
MDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.5 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for melanin-concentrating hormone, coupled to both G proteins that inhibit adenylyl cyclase and G proteins that activate phosphoinositide hydrolysis.
Gene References into Functions
  1. Polymorphisms in the MCHR1 gene are associated with differences in body composition and interact with physiologic and energy-related lifestyle factors. PMID: 24305679
  2. results suggest that MCHR1 may influence schizophrenia susceptibility, in particular among men and patients responding to conventional (nonclozapine) treatment PMID: 22081064
  3. SLC-1 protein human mutation demonstrated important genetic susceptibility of sporadic nonsyndromic hearing loss in China. PMID: 22154049
  4. DNA methylation at MCHR1 is allele-specific, age-dependent, body mass index-associated and affects transcription. PMID: 21637341
  5. two loss-of-function mutants were identified in markedly underweight individuals, raising the possibility that a lean phenotype may be linked to deficient MCHR1 signaling PMID: 20833795
  6. MCHR1 expression level was 1.6 times higher in vitiligo uninvolved skin (P < 0.05) and 2.23 times lower in involved skin (P < 0.05), when compared to healthy control skin. PMID: 20888736
  7. data suggest that RGS2 and RGS8 differentially associate with MCHR1 and may represent two distinct modes of signaling mechanisms in vivo PMID: 20633139
  8. Synthesis and biological evaluation in vitro of a selective, high potency peptide agonist of human melanin-concentrating hormone action at human melanin-concentrating hormone receptor 1. PMID: 11839762
  9. MCH1 and MCH2 receptors were investigated and are different from those in SVK14 cells. PMID: 12127971
  10. MCHR1 is expressed and functional in human skin PMID: 12176038
  11. MCHR1 receptor expression on most cell types can trigger, in the presence of MCH, cAMP synthesis and calcium mobilization in peripheral blood mononuclear cells (PBMCs). Moreover, MCH treatment decreases the CD3-stimulated PBMC proliferation in vitro. PMID: 12220661
  12. study demonstrates a complex interaction between melanin concentrating hormone receptor 1 and Gs protein-coupled signaling pathways PMID: 12865333
  13. multiple antibody binding sites on melanin-concentrating hormone receptor 1 in vitiligo, including regions between amino acids 1 to 138 and 139 to 298. PMID: 14632194
  14. Periplakin interferes with G protein activation by the melanin-concentrating hormone receptor-1 by binding to the proximal segment of the receptor C-terminal tail PMID: 15590649
  15. a single point mutation at position 255 (T255A), which is located at the junction of intracellular loop 3 and transmembrane domain 6, reduces the MCHR1 cell surface expression level to 20% of that observed for the wild-type receptor PMID: 15928315
  16. Association of MCHR1 alleles/haplotype detected might be related to juvenile-onset obesity, conditional on a particular genetic and/or environmental background. PMID: 15941924
  17. Our results suggest that MIZIP might play an important role in mammalian cells by associating with tubulin and thus might provide a link between MCHR1 and tubulin functions. PMID: 16039987
  18. study suggests that severe forms of obesity with early onset may be associated with single nucleotide polymorphisms in melanin-concentrating hormone receptor 1 (MCHR1) PMID: 16186414
  19. Study suggest that GPR24 variants may confer susceptibility to both bipolar affective disorder and schizophrenia. PMID: 16741940
  20. Single nucleotide polymorphisms of MCHR1 did not have effects on metabolic variables in humans. PMID: 18198296
  21. These data suggest that a functional interaction between MCHR1 and caveolin-1 in lipid rafts exists and provide a basis for further biochemical studies to understand the significance on MCH-mediated signal transduction events. PMID: 18722347
  22. analysis of epitope specificity of MCHR1 antibodies PMID: 19320743
  23. The 10-amino-acid cyclic core of the hMCH neuropeptide with the Arg attached to the N-terminus of the disulfide ring is sufficient for full activation of melanin-concentrating hormone receptor 1. PMID: 11478907

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highest level in brain, particularly in the frontal cortex and hypothalamus, lower levels in the liver and heart.
Database Links

HGNC: 4479

OMIM: 601751

KEGG: hsa:2847

STRING: 9606.ENSP00000249016

UniGene: Hs.248122

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*