Recombinant Human Membrane-associated progesterone receptor component 2 (PGRMC2)

Code CSB-CF017877HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
PGRMC2
Uniprot No.
Alternative Names
PGRMC2; DG6; PMBP; Membrane-associated progesterone receptor component 2; Progesterone membrane-binding protein; Steroid receptor protein DG6
Species
Homo sapiens (Human)
Expression Region
1-223
Target Protein Sequence
MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGEMLLNVAL VALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRIL LAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQM ESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for the maintenance of uterine histoarchitecture and normal female reproductive lifespan. May serve as a universal non-classical progesterone receptor in the uterus (Probable). Intracellular heme chaperone required for delivery of labile, or signaling heme, to the nucleus. Plays a role in adipocyte function and systemic glucose homeostasis. In brown fat, which has a high demand for heme, delivery of labile heme in the nucleus regulates the activity of heme-responsive transcriptional repressors such as NR1D1 and BACH1.
Gene References into Functions
  1. Demonstrate a change in myometriumPGRMC1 expression and changes in PGRMC1 and PGRMC2 cell localisation in association with parturition. PMID: 25266650
  2. It deserves further examination as data point to a role of PGRMC2 as tumor suppressor, migration inhibitor and regulator of cytochrome P450 proteins. PMID: 23276631
  3. In secretory phase endometrium from women with advanced stage endometriosis, PGRMC-2 expression is downregulated. PMID: 23793472
  4. Reversely, in the HO-8910 cells treated with CDDP alone, levels of both PGRMC1 and PGR were increased while the level of PGRMC2 was decreased PMID: 23970345
  5. PGRMC2 inhibits migration of SKOV-3 ovarian cancer cells in vitro. PMID: 23064006
  6. The expression of a novel progesterone-binding protein (hmPR1/PGMRC1) was investigated. Transcripts of this protein have been detected in human sperm. PMID: 15702432

Show More

Hide All

Subcellular Location
Membrane; Single-pass membrane protein. Nucleus envelope. Endoplasmic reticulum.
Protein Families
Cytochrome b5 family, MAPR subfamily
Tissue Specificity
Expressed by endometrial glands and stroma (at protein level).
Database Links

HGNC: 16089

OMIM: 607735

KEGG: hsa:10424

STRING: 9606.ENSP00000429301

UniGene: Hs.507910

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1