Recombinant Human Mitochondrial uncoupling protein 3 (UCP3)

Code CSB-CF025556HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
UCP3; SLC25A9; Mitochondrial uncoupling protein 3; UCP 3; Solute carrier family 25 member 9
Species
Homo sapiens (Human)
Expression Region
1-312
Target Protein Sequence
MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRG VLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRI LAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWK GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDV VKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRA LMKVQMLRESPF
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. As a result, energy is dissipated in the form of heat. May play a role in the modulation of tissue respiratory control. Participates in thermogenesis and energy balance.
Gene References into Functions
  1. findings indicate that polymorphisms rs3813929 and rs1800849 from 5-HT2C and UCP3 genes were related to type 2 diabetes mellitus prevalence among the Brazilian obese women candidates for bariatric surgery. PMID: 28977211
  2. In type 2 diabetics the combination of UCP3-55 CC and PPARgamma2 Pro12Ala genotypes is associated with significantly higher BMI than other PPARgamma2-UCP3 genotype combinations, partly due to a reduced ability in lipids oxidation. PMID: 27089973
  3. genetic association studies in population in Spain: Data suggest that responses among obese patients (weight loss and changes in insulin resistance/cardiovascular risk factors) to high protein/low carbohydrate reducing diet varies according to a genetic polymorphism in the promoter region of UCP3 (-55CT, rs1800849). PMID: 26848765
  4. Combined, our data suggest functional significance of UCP-3 for H/R resistance PMID: 26304588
  5. UCP3 overexpression limits keratinocyte proliferation and tumorigenesis through inhibition of Akt. PMID: 26310111
  6. Children with UCP-3 -55 T/T genotype had a significantly lower adjusted metabolic rate than the C allele carriers. PMID: 25081806
  7. A newly identified functional variant (rs1626521) in UCP-3 affects postprandial gastric functions and satiety and may contribute to weight gain and alter human mitochondrial function PMID: 25755013
  8. UCP3 genotype prevailed in the women of besieged Leningrad compared to relevant control groups of the persons of the same age who did not suffered hungry disaster. PMID: 25826986
  9. Studied the impact of SNPs in/near UCP3 and RPTOR on obesity-related traits. PMID: 25533680
  10. The study replicates in two independent populations the association between the -55CT polymorphism of UCP3 and a lower BMI. PMID: 24026107
  11. In patients with -55CC UCP3 genotype, a high mono-unsaturated hypocaloric diet reduced BMI, weight, waist circumference, waist to hip ratio, fat mass, LDL-cholesterol, total cholesterol and leptin levels. PMID: 24174365
  12. A higher prevalence of UCP3 rs11235972 GG genotype was observed in Chinese children with nonalcoholic fatty liver disease. PMID: 24124336
  13. T allele of the UCP3 gene was favourable in obtaining higher VOmax (maximum oxygen uptake)level and might be considered as endurance-related allele PMID: 23505621
  14. The T allele carriers of -55CT UCP3 polymorphism exhibit no metabolic response to weight loss induced by a hypocaloric diet rich in polyunsaturated fatty acids PMID: 23165529
  15. No association has been found between UCP3 -55C/T polymorphism and obesity in the populations investigated. (Meta-analysis) PMID: 23560041
  16. This study demonistrated that Polymorphisms in uncoupling protein genes UCP3 is not associated with HIV-associated sensory neuropathy in African individuals. PMID: 23521650
  17. A significant association has been found between the UCP2 Ala55Val polymorphisms and increased susceptibility for type 2 diabetes mellitus in Asians. PMID: 23365654
  18. Results show prevalence of mutant UCP genotypes was similar in patients with metabolic syndrome (75.7% wild genotype and 24.3% mutant genotype) and without MS (69.7% wild genotype and 30.3% mutant genotype). PMID: 22811361
  19. genetic association study in population in Spain: Data suggest that a polymorphism in promoter region of UCP3 gene (-55CC->CT) is associated with fat distribution/adiposity and cardiovascular risk factors in obese subjects with type 2 diabetes. PMID: 21897112
  20. Report interaction of -55CT polymorphism of UCP3 gene with Trp64Arg polymorphism of beta3adrenoreceptor gene on insulin resistance in obese patients. PMID: 22774401
  21. Our results also suggest that telmisartan, which increases fatty acid oxidation in rat skeletal muscle, also improves UCP3 wt and mutant protein activity, including the dominant-negative UCP3 mutants. PMID: 21544083
  22. UCP3 -55C/T polymorphism may be risk factor for susceptibility to type 2 diabetes in individuals of Asian descent, but not in individuals of European descent (Meta-Analysis) PMID: 21751002
  23. The sensitivity of SERCA to mitochondrial ATP production suggests that mitochondria control the local ATP availability at ER Ca(2+) uptake and release sites. PMID: 21775425
  24. conclude that a more efficient uncoupling process has a beneficial effect on the aging muscle by slowing down its age related decay PMID: 21336965
  25. The genotype and the allele frequencies of -55C/T of the UCP3 gene showed a significant protective effect against the development of diabetes. PMID: 21175267
  26. Results suggest that adaptation to climate influenced the global distribution of allele frequencies in UCP1 and UCP3 and provide an independent source of evidence for a role in cold resistance for UCP3. PMID: 20802238
  27. Data demonstrate that distinct sites in the IML2 of UCP3 effect mitochondrial uptake of high and low Ca(2+) signals. PMID: 21047682
  28. -55CT genotype is associated with high insulin resistance and low adiponectin levels than -55CC genotype. Patients with -55CT genotype have more frequently moderate-severe steatosis and inflammation than -55CC genotype PMID: 20694293
  29. Polymorphism -55C/T of the UCP3 promotor did not have an effect on weight loss or clinical outcomes after bariatric surgery. PMID: 18484143
  30. Cardiorespiratory fitness modifies the association between the rs1800849 polymorphism and homocysteine so that the negative effect of the T allele does not persist in youth with moderate to high levels of fitness. PMID: 20031128
  31. mutant-type group of -55CC UCP3 gene patients had higher weight, fat mass, and insulin resistance than wild-type group. PMID: 19913848
  32. Uncoupling protein 3 gene is associated with body composition changes with training. PMID: 11842047
  33. mitochondrial uncoupling protein, involved in thermogenesis. mRNA levels elevated in weight loss associated with gastrointestinal adenocarcioma. PMID: 11875702
  34. Fasting activates the gene expression of UCP3 independent of lipid transport and oxidation genes in skeletal muscle suggesting a role in regulation of FA homeostasis during fasting PMID: 12051710
  35. UCP3 protein content is related to energy metabolism in humans and might help in the metabolic adaptation to cold exposure PMID: 12075570
  36. Depressed UCP3 expression may be an important mechanism for reducing the formation of oxygen-derived free radicals. PMID: 12145475
  37. Metabolic and anthropometric factors related to skeletal muscle UCP3 gene expression in healthy human adults. PMID: 12217879
  38. expression of UCP3 mRNA was dependent on human muscle differentiation PMID: 12351640
  39. role of UCP3 in postnatal activation of lipid oxidation in skeletal muscle and suggest the involvement of UCP3 in the delayed activation of mitochondrial energy conversion in very immature preterm neonates. PMID: 12612210
  40. Training status did not change skeletal muscle fiber hierarchical UCP3 protein expression in different fiber types. It affected UCP3 content more in type I and type IIa than in type IIx muscle fibers. PMID: 12634927
  41. purine nucleotides must be the physiological inhibitors of UCP3-mediated uncoupling in vivo. PMID: 12670931
  42. study of isolation, refolding, transport properties, and regulation of recombinant UCP3 PMID: 12734183
  43. Uncoupling protein 3 polymorphisms are associated with waist-to-hip ratio. PMID: 12756473
  44. This is the first study to demonstrate a downregulation of skeletal muscle UCP3 mRNA expression after the lowering of plasma free fatty acids concentrations in humans, despite an increase in energy expenditure upon beta2-adrenergic stimulation. PMID: 12824081
  45. convergence of MyoD and PPAR-dependent pathways provides a molecular mechanism for skeletal muscle specificity and fatty acid regulation of the human UCP3 gene. PMID: 12843208
  46. Up-regulation of UCP3 in riboflavin-responsive, multiple acylcoenzyme A dehydrogenase deficiency is due to accumulation of muscle fatty acid/acylCoA. PMID: 14671191
  47. Results support a role for UCP3 in fuel substrate management and energy metabolism, which may influence body weight regulation. PMID: 15045692
  48. Association between BMI and the UCP3 -55 C-->T polymorphism in diabetic nephropathy. PMID: 15120704
  49. IGF-1 may protect from hyperglycemia-induced oxidative stress and neuronal injuries by regulating mitochondrial membrane potential, possibly by the involvement of UCP3. PMID: 15211595
  50. No association was found between the -55 C/T polymorphism within the uncoupling protein 3 gene and the ultra-endurance performance of triathletes. PMID: 15346230

Show More

Hide All

Involvement in disease
Obesity (OBESITY)
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity
Only in skeletal muscle and heart. Is more expressed in glycolytic than in oxidative skeletal muscles.
Database Links

HGNC: 12519

OMIM: 601665

KEGG: hsa:7352

STRING: 9606.ENSP00000323740

UniGene: Hs.101337

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1