Recombinant Human Myelin proteolipid protein(PLP1)

In Stock
Code CSB-CF018202HU
Product Type Transmembrane Protein
Size US$1674
Uniprot No. P60201
Lead Time 3-7 business days
Relevance This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF
Research Area Others
Source in vitro E.coli expression system
Gene Names PLP1
Protein Names Lipophilin PLP
Expression Region 2-277aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 35.5 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.
Involvement in disease Leukodystrophy, hypomyelinating, 1 (HLD1); Spastic paraplegia 2, X-linked (SPG2)
Subcellular Location Cell membrane, Multi-pass membrane protein, Myelin membrane
Protein Families Myelin proteolipid protein family
Database Links

HGNC: 9086

OMIM: 300401

KEGG: hsa:5354

STRING: 9606.ENSP00000305152

UniGene: Hs.1787

Related Products

PLP1 Antibodies

PLP1 Antibodies for Human

PLP1 Proteins

PLP1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.