Recombinant Human Neuromedin-U receptor 2(NMUR2)

Code CSB-CF875632HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9GZQ4
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVVYVPIFVVGV IGNVLVCLVILQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCY FKTALFETVCFASILSITTVSVERYVAILHPFRAKLQSTRRRALRILGIVWGFSVLFSLP NTSIHGIKFHYFPNGSLVPGSATCTVIKPMWIYNFIIQVTSFLFYLLPMTVISVLYYLMA LRLKKDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAICWAPFHIDRLFFSFVEEWSES LAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPA QRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT
Source in vitro E.coli expression system
Gene Names NMUR2
Protein Names Recommended name: Neuromedin-U receptor 2 Short name= NMU-R2 Alternative name(s): G-protein coupled receptor FM-4 G-protein coupled receptor TGR-1
Expression Region 1-415
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the neuromedin-U and neuromedin-S neuropeptides.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Predominantly expressed in the CNS, particularly in the medulla oblongata, pontine reticular formation, spinal cord, and thalamus. High level in testis whereas lower levels are present in a variety of peripheral tissues including the gastrointestinal trac
Database Links

HGNC: 16454

OMIM: 605108

KEGG: hsa:56923

STRING: 9606.ENSP00000255262

UniGene: Hs.731911

Related Products

NMUR2 Antibodies

NMUR2 Antibodies for Homo sapiens (Human)

NMUR2 Proteins

NMUR2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.