Recombinant Human Neuropeptide Y receptor type 1 (NPY1R)

Code CSB-CF016035HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
NPY1R; NPYR; NPYY1; Neuropeptide Y receptor type 1; NPY1-R
Species
Homo sapiens (Human)
Expression Region
1-384
Target Protein Sequence
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is NPY > [Pro-34] PYY, PYY and [Leu-31, Pro-34] NPY > NPY (2-36) > [Ile-31, Gln-34] PP and PYY (3-36) > PP > NPY free acid.
Gene References into Functions
  1. the current review aims to compile, evaluate and summarise current knowledge on PYY, with particular emphasis on obesity and diabetes treatment, and the importance of specific Y receptor interactions for this. PMID: 29412828
  2. crystal structures of the human Y1R bound to the two selective antagonists UR-MK299 and BMS-193885 at 2.7 and 3.0 A resolution, respectively PMID: 29670288
  3. NPY1R plays an inhibitory role in tumor growth and may be a promising therapeutic target for Hepatocellular carcinoma PMID: 27262566
  4. expressed in to B and T lymphocytes and mast cells in infantile hemangiomas PMID: 27889920
  5. MAPK activation by NPY Y1 receptors is an internalization-independent pathway and that this receptor can transactivate the IGFR receptor. PMID: 25817573
  6. Report design of argininamide-type NPY1R antagonists. PMID: 25884646
  7. Y1R expression in visceral adipose tissue might be an indicator of increased risk of metabolic syndrome. PMID: 23838112
  8. The influence of beta-arrestin adaptors and endocytosis mechanisms on plasma membrane diffusion and particle brightness of GFP-tagged neuropeptide Y (NPY) receptors, was investigated. PMID: 22487268
  9. Npy1 receptor transgene overexpression is associated with modest anxiolytic-like effect on mice in the open field and elevated plus maze tests. PMID: 21971867
  10. For the first time we report a significant association between nicotine dependence and DRD5, NPY1R MAP3K4 single nucleotide polymorphism. PMID: 22309839
  11. neuropeptide Y1 and Y2 receptors were expressed in 33 percent of testicular tumors and Y1 on intratumoral blood vessels in 50 percent of testicular tumors PMID: 21295110
  12. The increased expression of NPY Y1 receptor may be related to local blood flow reduction and structural changes of pelvic supporting tissue in patients with pelvic organ prolapse. PMID: 18953866
  13. A C-terminal tyrosine-based motif is critical for the constitutive internalization of Y(1) receptors lacking the last 32 C-terminal amino acids. PMID: 20837140
  14. results suggest that the receptor-ligand interactions have changed during evolution after Y1 and Y2 arose from a common ancestral receptor PMID: 20471432
  15. NPY1R and NPY5R have roles in nutrient-specific food intake in Europeans PMID: 19759915
  16. the NPY Y(1) receptor induces the expression of CRE containing target genes through the CaM kinase-CREB pathway PMID: 11814622
  17. Peptide YY and neuropeptide Y exert their effects through the NPY1 receptors in human colon mucosa. PMID: 11906964
  18. human NPY Y1 and NPY Y2 receptors were detected in cerebral, meningeal, and coronary arteries using reverse transcriptase-polymerase chain reaction (RT-PCR); in addition, the trigeminal and superior cervical ganglia were positive for both receptors PMID: 12084524
  19. Expression of Y1 receptors characterize reactive and proliferating glial cells of diseased retina and may be involved in proliferation of injured glial cells causing regrowth of vitreoretinopathy membranes and consequent secondary retinal detachments. PMID: 12203398
  20. High expression of neuropeptide Y receptor Y1 is associated with tumors of the human adrenal gland and extra-adrenal paraganglia PMID: 15623622
  21. Neuropeptide-Y induced endothelial cell migration was mimicked by agonists and fully blocked by antagonists for any specific NPY receptor (NPY1R). PMID: 16891622
  22. data suggest that the K374T variant is a rare, nonfunctional polymorphism of the NPY-Y1R gene and that mutations of the highly conserved NPY-Y1R gene do not represent a frequent mechanism underlying human idiopathic central pubertal disorders. PMID: 17140570
  23. Ewing sarcoma family of tumors expressed the NPY receptor subtype Y1 on tumor cells in remarkably high incidence PMID: 18698022
  24. ICL3 stabilizes the Y1 receptor in the inactive state and confers structural properties critical for regulating Y receptor activation and signal transduction PMID: 18812316
  25. Results suggest that rabbit and human Y1, Y2 and Y5 receptor subtypes are well conserved, whereas Y4 receptors are less well conserved. PMID: 19481128
  26. the studied LEP, NPY1R and GPR54 variants do not have a major influence upon pubertal timing in Caucasian women. PMID: 19506390
  27. novel pathophysiological links between the NPY1R locus, autonomic activity, and blood pressure PMID: 19712806

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 7956

OMIM: 162641

KEGG: hsa:4886

STRING: 9606.ENSP00000354652

UniGene: Hs.519057

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1