Recombinant Human P2Y purinoceptor 6 (P2RY6)

Code CSB-CF618975HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
P2RY6; PP2891; P2Y purinoceptor 6; P2Y6
Species
Homo sapiens (Human)
Expression Region
1-328
Target Protein Sequence
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL FYFTQKKFRRRPHELLQKLTAKWQRQGR
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for extracellular UDP > UTP > ATP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. Prostaglandin E2 glyceryl ester is an endogenous agonist of the nucleotide receptor P2Y6. PMID: 28539604
  2. The present study shows that sustained activation of P2Y6R may contribute to intestinal tumorigenesis by blocking the apoptotic process and by contributing to chemoresistance, a substantial concern in the treatment of patients with CRC. PMID: 29454075
  3. UDP/P2Y6 receptor signaling is involved in the regulation of IgE-dependent degranulation in basophils, which might stimulate the P2Y6 receptor via the autocrine secretion of UTP. Thus, this receptor represents a potential target to regulate IgE-dependent degranulation in basophils during allergic diseases. PMID: 28318884
  4. Expression levels of P2Y6 receptor were higher in Parkinson's disease patients compared to healthy controls. PMID: 28219441
  5. These data suggest that, without infection, inactivated-H5N1 induces mRNA expression of IL-6 and CXCL8 by a mechanism, or mechanisms, requiring interaction between viral hemagglutinin and alpha-2,3 sialic acid receptors at the cell membrane of host cells, and involves activation of P2Y6 purinergic receptors. PMID: 28494003
  6. Rescuing miR-185 expression to inhibit P2Y6 may represent a therapeutic strategy against human aortic vascular smooth muscle cells dysfunction and hypertension. PMID: 28277742
  7. data demonstrate that HNP-1 induces IL-8 production not only through P2Y6, but also through additional P2 receptors via an ERK1/2-dependent mechanism in intestinal epithelial cells. PMID: 25816245
  8. nucleotides released during the airway inflammatory processes will activate P2Y6 receptors, which will lead to further release of inflammatory cytokines. PMID: 25243587
  9. Data indicate that after P2Y6 receptor stimulation both phospholipase D (PLD) and DGKzeta enzymes are responsible for producing phosphatidic acid (PA). PMID: 23723068
  10. Using rat P2Y6 recombinant protein expressed in human astrocytoma cells, the authors found that the P2Y6 receptor is highly selective for UDP over UTP. PMID: 8700127
  11. no obvious correlation was found between the expression of P2Y6 and breast cancer cell proliferation PMID: 22558990
  12. Report role of ecto-NTPDases on UDP-sensitive P2Y(6) receptor activation during osteogenic differentiation of primary bone marrow stromal cells from postmenopausal women. PMID: 21898410
  13. P2Y(6) receptor signaling pathway may be a potential therapeutic target for MSU-associated inflammatory diseases, such as tophaceous gout. PMID: 22102722
  14. P2Y6 receptor transgene is an important endogenous inhibitor of T cell function in mice with allergic pulmonary inflammation PMID: 21724990
  15. human microvascular endothelia exposed to inflammatory stimuli, followed by measurements of P2Y or P2X transcriptional responses, showed a selective induction of the P2Y(6) receptor PMID: 21173118
  16. activation of P2Y6 receptor mediates the UVB-radiation-induced activation of p38 MAPK and expression of COX-2 PMID: 21388279
  17. P2Y6 receptors and ADAM17 mediates the low-dose gamma-radiation-induced activation of EGFR. PMID: 21268712
  18. modulation of human cavernosal smooth muscle relaxation can be achieved by activation of the P2Y6 receptor via non-neuronal and non-NO-dependent mechanisms, reinforcing the possible involvement of purinergic signalling in the erectile process PMID: 17971163
  19. hypertonic stress increases T cell interleukin-2 expression through a mechanism that involves ATP release, P2 receptor, and p38 MAPK activation PMID: 12464620
  20. P2Y(6) receptors interact rapidly with the TNF alpha-related intracellular signals to prevent apoptotic cell death. PMID: 12623123
  21. P2Y6 receptors highly responsive to UDP are endogenously expressed in human neuroblastoma SK-N-BE(2)C cells and they are involved in modulation of phospholipase C-coupled receptor-mediated Ca2+ mobilization by depleting the IP3-sensitive Ca2+ stores PMID: 12716436
  22. findings expand the pro-inflammatory biology of UDP mediated by the P2Y6 receptor PMID: 15796906
  23. P2Y receptors revealed that the P2Y6 (ligand of UDP) signaling pathway plays a predominant role in mediating human neutrophil peptides-induced IL-8 production. PMID: 16322472
  24. inotropic effects of UDP, mediated by P2Y6 receptors PMID: 16543499
  25. on/off effect of IL-13 on P2Y(6)-induced Cl-secretion may help to identify the molecular determinants responsible for the CaCC channel activity PMID: 17762175
  26. P2Y6 receptor expression is increased by the stress-associated inflammatory response of Caco-2 intestinal epithelial cells. PMID: 18250478
  27. These results indicate that activation of Galpha(12/13) in cardiomyocytes by the extracellular nucleotides-stimulated P2Y(6) receptor triggers fibrosis in pressure overload-induced cardiac fibrosis PMID: 19008857
  28. P2Y agonists stimulate Ca(2+)-dependent Cl(-) secretion across human bronchial epithelia and that the cAMP/PKA pathway regulates apical but not basolateral P2Y(6) receptor-coupled ion transport in human bronchial epithelia PMID: 19011163
  29. Human mast cells express uridine diphosphate-selective P2Y6 receptors that cooperate with type 1 cysteinyl-leukotriene receptors to promote cell survival and chemokine generation by a pathway involving reciprocal ligand-mediated cross-talk. PMID: 19124756

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 8543

OMIM: 602451

KEGG: hsa:5031

STRING: 9606.ENSP00000309771

UniGene: Hs.16362

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1