Recombinant Human Peroxisomal membrane protein PEX16(PEX16)

Code CSB-CF897573HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9Y5Y5
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLL NDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALVQLAK AVLRMLLLLWFKAGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQN TPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAEFLYIARPLLHLLSLGLWGQ RSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTILLLYYLLRSPFYDRFSEARIL FLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG
Source in vitro E.coli expression system
Gene Names PEX16
Protein Names Recommended name: Peroxisomal membrane protein PEX16 Alternative name(s): Peroxin-16 Peroxisomal biogenesis factor 16
Expression Region 1-336
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for peroxisome membrane biogenesis. May play a role in early stages of peroxisome assembly. Can recruit other peroxisomal proteins, such as PEX3 and PMP34, to de novo peroxisomes derived from the endoplasmic reticulum (ER). May function as receptor for PEX3.
Involvement in disease Peroxisome biogenesis disorder complementation group 9 (PBD-CG9); Peroxisome biogenesis disorder 8A (PBD8A); Peroxisome biogenesis disorder 8B (PBD8B)
Subcellular Location Peroxisome membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane
Protein Families Peroxin-16 family
Database Links

HGNC: 8857

OMIM: 603360

KEGG: hsa:9409

STRING: 9606.ENSP00000241041

UniGene: Hs.100915

Related Products

PEX16 Antibodies

PEX16 Antibodies for Homo sapiens (Human)

PEX16 Antibodies for Human

PEX16 Proteins

PEX16 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.