Recombinant Human Phosphatidylethanolamine N-methyltransferase (PEMT)

Code CSB-CF017780HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
PEMT
Uniprot No.
Alternative Names
PEMT; PEMPT; PNMT; Phosphatidylethanolamine N-methyltransferase; PEAMT; PEMT; PEMT2; Phospholipid methyltransferase; PLMT
Species
Homo sapiens (Human)
Expression Region
2-199
Target Protein Sequence
TRLLGYVDPLDPSFVAAVITITFNPLYWNVVARWEHKTRKLSRAFGSPYLACYSLSVTIL LLNFLRSHCFTQAMLSQPRMESLDTPAAYSLGLALLGLGVVLVLSSFFALGFAGTFLGDY FGILKEARVTVFPFNILDNPMYWGSTANYLGWAIMHASPTGLLLTVLVALTYIVALLYEE PFTAEIYRQKASGSHKRS
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the three sequential steps of the methylation pathway of phosphatidylcholine biosynthesis, the SAM-dependent methylation of phosphatidylethanolamine (PE) to phosphatidylmonomethylethanolamine (PMME), PMME to phosphatidyldimethylethanolamine (PDME), and PDME to phosphatidylcholine (PC).
Gene References into Functions
  1. Study found three gene variants (CLOCK-rs4864548, PEMT-rs936108, and GHRELIN-rs696217) that exhibited uncorrected gene-by-sleep duration interactions in relation to BMI z-scores in a cohort of New Zealand European children. However, no interactions were identified in percentage body fat differences. Notably, these interactions are evident without detectable effects on sleep duration. PMID: 28899534
  2. In genotypic combination analysis considering PEMT -744GG/CHDH +432GG/BHMT +742GG as the reference combination, PEMT -744GC/CHDH +432GG/BHMT +742GG genotypic combination was significantly higher in mothers of a down syndrome child compared with that in control mothers with an odds ratio of 2.061 (95% CI: 1.10-3.86, P=0.0342). PMID: 27677362
  3. Results showed that PEMT mRNA expression in liver tissues of non-alcoholic steatohepatitis (NASH) patients was significantly lower than those with simple steatosis suggesting a distinct clinical entity of lean NASH with insufficiency of PEMT activities. PMID: 26883167
  4. a significant association between the PEMT rs7946 A-allele and a risk of nonalcoholic fatty liver disease, with the effect being more prominent in East-Asians, but not in non-Asians (Meta-Analysis) PMID: 26636496
  5. Data show that phosphatidylethanolamineN-methyltransferase (PEMT) rs12325817 polymorphism only marginally changed the association value with academic achievement. PMID: 26728177
  6. Data suggest that maternal dietary intake during lactation (here, choline intake exceeding dietary recommendations) can alter hepatic PEMT activity and increase choline content of breast milk. PMID: 26025328
  7. MTHFR rs1801131 C allele and PEMT rs4646356 T allele were associated with a high risk of type 2 diabetes in Han Chinese. PMID: 25074646
  8. The GG genotype of the PEMT G774C polymorphism, higher levels of serum homocysteine and lower levels of serum betaine are associated with an increased risk of microangiopathy in patients with diabetes. PMID: 23794489
  9. PEMT is a functional single nucleotide polymorphism (rs7946) in PEMT with sporadic Alzheimer's disease risk in a Han Chinese population. PMID: 21881829
  10. the PEMT -774G>C and CHDH +432G>T polymorphisms were associated with sperm concentration. This finding suggests a possible influence of these genes on sperm quality PMID: 22387881
  11. genetic association studies on endometriosis in a population of women in Poland: Data suggest interaction between an SNP in PEMT (rs4244593) and an SNP in MTHFR (Ala222Val; rs1801133) in infertile women with some indication of endometriosis. PMID: 21429654
  12. nvestigation of factors affecting liver PEMT activity: PEMT activity is lower in liver samples from women who are homozygous for an SNP in PEMT (rs12325817) PMID: 21411618
  13. allele-specific ablation of estrogen receptor-DNA interaction in the PEMT locus prevents hormone-inducible PEMT expression, conferring risk of choline deficiency in women PMID: 21059658
  14. Choline requirements for both women are increased by the genetic polymorphism rs12325817 in phosphatidylethanolamine-N-methyltransferase. PMID: 20861172
  15. Total intake of choline and genotype can influence the concentrations of choline and its metabolites in the breast milk and blood of lactating women and thereby affect the amount of choline available to the developing infant. PMID: 20534746
  16. The allele frequency of PEMT did not show a significant difference between normal control group and fatty liver patients (P=0.222). PMID: 19262398
  17. an examination of the membrane topography of this enzyme PMID: 12431977
  18. PEMT2 mRNA expression was inversely related to tumor proliferation and to histologic grade. PMID: 12931022
  19. PEMT-mediated Hcy secretion correlated with the methyltransferase activity of the enzyme, independently of subcellular localization PMID: 15927961
  20. Val175Met variant of PEMT could be a susceptibility candidate to nonalcoholic steatohepatitis (NASH), because it is more frequently observed in NASH patients and non-obese persons with Val175Met variant of PEMT are facilitated to develop NASH PMID: 17391797
  21. Human PEMT genes have three unique transcription start sites, which are indicative of either multiple promoters and/or alternative splicing. PMID: 17456783
  22. The present results suggest that the PEMT gene may contribute to the etiology of schizophrenia. PMID: 17720317
  23. single nucleotide polymorphisms of choline-metabolizing genes, PEMT -774G>C (rs12325817) and CHDH +432G>T (rs12676), were found be related to breast cancer risk PMID: 18230680
  24. These data suggest that polymorphisms in PEMT genes relevant to choline metabolism modulate parameters of choline status when folate intake is restricted. PMID: 19167960
  25. in folate-deplete men, several factors with roles in 1-carbon metabolism interact with the MTHFR C677T genotype to affect plasma homocysteine PMID: 19211833
  26. No association of the rs4646396 SNP in the PEMT locus with schizophrenia in a Chinese case-control sample. PMID: 19647326

Show More

Hide All

Subcellular Location
[Isoform 1]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.; [Isoform 2]: Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Class VI-like SAM-binding methyltransferase superfamily, PEMT/PEM2 methyltransferase family
Database Links

HGNC: 8830

OMIM: 602391

KEGG: hsa:10400

STRING: 9606.ENSP00000255389

UniGene: Hs.714193

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×