Recombinant Human Potassium channel subfamily K member 13(KCNK13)

Code CSB-CF862058HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9HB14
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANF SRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPAT VGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAG QCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGF GDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCP QCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASL AILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR
Source in vitro E.coli expression system
Gene Names KCNK13
Protein Names Recommended name: Potassium channel subfamily K member 13 Alternative name(s): Tandem pore domain halothane-inhibited potassium channel 1 Short name= THIK-1
Expression Region 1-408
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Potassium channel displaying weak inward rectification in symmetrical K(+) solution.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Database Links

HGNC: 6275

OMIM: 607367

KEGG: hsa:56659

STRING: 9606.ENSP00000282146

UniGene: Hs.510191

Related Products

KCNK13 Antibodies

KCNK13 Antibodies for Homo sapiens (Human)

KCNK13 Antibodies for Human

KCNK13 Proteins

KCNK13 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.