Recombinant Human Potassium voltage-gated channel subfamily A member 3 (KCNA3)

Code CSB-CF012008HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
KCNA3; HGK5; Potassium voltage-gated channel subfamily A member 3; HLK3; HPCN3; Voltage-gated K(+ channel HuKIII; Voltage-gated potassium channel subunit Kv1.3
Species
Homo sapiens (Human)
Expression Region
1-575
Target Protein Sequence
MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDH LLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLK TLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIF SEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVS VLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGSRAGASSFSDPFFVVET LCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSL AILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE ADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIV SNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHS AFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.
Gene References into Functions
  1. T-cell dependency on Kv1.3 or KCa3.1 might be irreversibly modulated by antigen exposure. PMID: 28248292
  2. Kv1.3 methylation may serve as diagnostic and prognostic markers in colorectal cancer. PMID: 28472608
  3. the tertiary structure of the C-terminal domain of Kv1.3 is necessary and sufficient for Kv1.3- KCNE4 interaction. PMID: 27802162
  4. results identify a caveolin-binding domain in Kv1 channels and highlight the mechanisms that govern the regulation of channel surface localization during cellular processes PMID: 26931497
  5. we report that Kv1.3-NPs reduced NFAT activation and CD40L expression exclusively in CD45RO(+) T cells. Furthermore, Kv1.3-NPs suppressed cytokine release and induced a phenotype switch of T cells from predominantly memory to naive. PMID: 26994905
  6. The implication of Kv1.3 in a wide repertoire of human pathologies indicates this channel is an important therapeutic target. PMID: 26634786
  7. Results contribute to the characterization of leukemic B cells, as it shows that upregulation of Kv1.3 in pathologic B lymphocytes is linked to the oncogenic B-RAF signaling. PMID: 26393354
  8. Data suggest that C-terminus is necessary for Kv1.3-induced cell proliferation; the mechanism involves accessibility of key docking sites at the C terminus; phosphorylation of Tyr-447 by MAP kinase signal cascade appears crucial. PMID: 26655221
  9. concluded that Kv1.3 may stimulate macrophage migration through the activation of ERK. PMID: 26748289
  10. The inhibition of Kv1.3 channels might be involved in antiproliferative and proapoptotic effects of the compounds observed in cancer cell lines expressing these channels. PMID: 25688010
  11. Kv1.3 channels modulate human vascular smooth muscle cells proliferation independently of mTOR signaling pathway. PMID: 25208915
  12. actin dynamics regulates the membrane motility of Kv1.3 channels. PMID: 25739456
  13. The increment and decrement of the basic residue number in a positively charged S4 sensor of Kv1.3 channel yields conductance-voltage relationship curves in the positive direction by approximately 31.2 mV and 2-4 mV PMID: 25944908
  14. the association between Kv1.3 and the COPII cargo adaptor subunit isoform Sec24a PMID: 26156069
  15. Findings reveal that alpha-defensins are endogenous inhibitors of potassium voltage-gated channel subfamily A member 3 (Kv1.3) with distinct interaction mechanisms. PMID: 26148969
  16. This study demonstrated that Potassium channel Kv1.3 is highly expressed by microglia in human Alzheimer's disease. PMID: 25362031
  17. These results demonstrate that Kv1.3 channels are primarily localized in the nucleus of several types of cancer cells and human brain tissues where they are capable of regulating nuclear membrane potential and activation of transcription factors PMID: 25829491
  18. the small molecule Kv1.3 blocker PAP-1 dose-dependently inhibited proliferation and suppressed IL-2 and IFN-gamma production. PMID: 25175978
  19. Treatment with Acacetin for 24 h significantly inhibited Kv1.3 protein expression. PMID: 25301362
  20. results revealed that the deficient expression of Kv1.3 channel would cause the less Ca2+ signal, leading to the less efficiency in secretion PMID: 24594979
  21. Targeting the ion channel Kv1.3 with scorpion venom peptides engineered for potency, selectivity, and half-life PMID: 24939846
  22. We show the structure of the T1 domain derived from the voltage-dependent potassium channel K(v)1.3 of Homo sapiens sapiens at 1.2 A resolution crystallized under near-physiological conditions. PMID: 24114469
  23. Authors show the helical transmembrane S3b-S4 hairpin ("paddle") of a voltage-gated potassium (Kv) channel, a critical region of the Kv voltage sensor, forms in the ribosomal vestibule. PMID: 24055377
  24. CMYA5 is a new potential substrate of Kcna3 in human heart PMID: 23335746
  25. diseases. Our present results indicate a critical role for Kv1.3 in the conversion of CD8+ T cells into potential pathogenic effector cells with cytotoxic function. PMID: 23382885
  26. role of Kv1.3 in modulating cholesterol-metabolism-associated molecules in human acute monocytic leukemia cell-derived macrophages (THP-1 macrophages) and human monocyte-derived macrophages exposed to oxidized LDL PMID: 23099443
  27. Diclofenac can significant down-regulate the expression of Kv1.3 and Kir2.1 channels in human macrophages, lower their membrane potential and inhibit the process of foam cell formation. PMID: 22931594
  28. MMP23-PD suppresses the voltage-gated potassium channel KV1.3, but not the closely related KV1.2 channel, by trapping the channel intracellularly. PMID: 23300077
  29. GrB released from T cells induced neurotoxicity by interacting with the membrane bound Gi-coupled PAR-1 receptor and subsequently activated Kv1.3 and Notch-1 PMID: 22952817
  30. and immunocytochemistry experiments revealed an association between K(v)1.5, K(v)beta1.3, the receptor for activated C kinase (RACK1), PKCbetaI, PKCbetaII, and PKCtheta. PMID: 22547057
  31. Selective knockdown of protein kinase A 1(PKAI) eliminates modulation of Kv1.3 channels by PKAI activation. PMID: 22378744
  32. Data suggest that rituximab induces apoptosis of malignant B lymphocytes by stimulating FcgammaRIIB receptors and inhibiting Kv1.3 channels. PMID: 22192444
  33. CD4+CD28null T cells expressed small numbers of the voltage-gated Kv1.3 and intermediate-conductance Ca2+-activated K+ channel KCa3.1 when quiescent, but increased Kv1.3 expression 4-fold with little change in KCa3.1 levels upon activation. PMID: 22169811
  34. expression of Kv1.5 and Kv1.3 increased in skeletal muscle tumorigenesis in a close relationship with malignancy. PMID: 22360360
  35. hypoxia disrupts AP1/clathrin-mediated forward trafficking of Kv1.3 from the trans-Golgi to the plasma membrane thus contributing to decreased Kv1.3 surface expression in T lymphocytes. PMID: 22134923
  36. Functional blockade of the voltage-gated potassium channel Kv1.3 mediates reversion of T effector to central memory lymphocytes through SMAD3/p21cip1 signaling. PMID: 22110135
  37. Our findings provide the first evidence that KCNA3 is associated with autoimmune pancreatitis and suggest that KCNA3 may influence the risk for autoimmune pancreatitis PMID: 22045429
  38. PDZ binding domain-dependent interactions affect both Kv1.3 localization (plasma membrane vs. golgi complex) and electrophysiological function. PDZ interactions affect localization and function via independent mechanisms. PMID: 21726550
  39. regulatory switch of Kv1.3 activity in peripherally induced Tregs may constitute an important contributing factor in the signaling rewiring associated with the development of these cells PMID: 21834013
  40. findings are not supportive of a role for Kv1.3 in the modulation of peripheral insulin sensitivity PMID: 21586699
  41. A mutation in Kv1.3 (A413C) doubles the stoichiometry of emopamil but not verapamil for blocking the channel. PMID: 21220411
  42. K(V)1.3 potassium channels are functional in proliferating mouse and human vascular smooth muscle cells and have positive effects on cell migration. Blockers of the channels may be useful as inhibitors of neointimal hyperplasia. PMID: 20884640
  43. treatment with short hairpin RNA (shRNA) against Kv1.3, significantly blocked A549 cells' proliferation PMID: 21087602
  44. higher expression on major T-lymphocyte subsets of newborns compared to adult ones except for T(h)1 lymphocytes PMID: 20601376
  45. increased impact on T-lymphocyte activation in type 1 diabetes mellitus patients PMID: 20603149
  46. Kv1.3 contributes an unusual nonconducting role - the detection of metabolic state. PMID: 20865378
  47. role of this channel in the sequence of events leading to Bax-induced cytochrome c release PMID: 20114030
  48. A comparison of the expression patterns of Kv1.3 and Kv1.5 in the human fetus. PMID: 20798505
  49. trafficking abnormalities contribute to defective signaling in systemic lupus erythematosus T cells PMID: 19959227
  50. Given that glutamate is present in plasma and that both mGluRs and K(V)1.3 channels regulate T-lymphocyte responsiveness, our finding may account for the presence of immune-associated alterations in AD. PMID: 19850126

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.3/KCNA3 sub-subfamily
Database Links

HGNC: 6221

OMIM: 176263

KEGG: hsa:3738

STRING: 9606.ENSP00000358784

UniGene: Hs.169948

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1