Recombinant Human Probable G-protein coupled receptor 27(GPR27)

Code CSB-CF885717HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9NS67
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MANASEPGGSGGGEAAALGLKLATLSLLLCVSLAGNVLFALLIVRERSLHRAPYYLLLDL CLADGLRALACLPAVMLAARRAAAAAGAPPGALGCKLLAFLAALFCFHAAFLLLGVGVTR YLAIAHHRFYAERLAGWPCAAMLVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGA PGALGFLLLLAVVVGATHLVYLRLLFFIHDRRKMRPARLVPAVSHDWTFHGPGATGQAAA NWTAGFGRGPTPPALVGIRPAGPGRGARRLLVLEEFKTEKRLCKMFYAVTLLFLLLWGPY VVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVVCFLFNRELRDCFRAQFPCCQSPR TTQATHPCDLKGIGL
Source in vitro E.coli expression system
Gene Names GPR27
Protein Names Recommended name: Probable G-protein coupled receptor 27 Alternative name(s): Super conserved receptor expressed in brain 1
Expression Region 1-375
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor. Possible candidate for amine-like G-protein coupled receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Highly expressed as a 3.0 kb transcript in brain, ovary, testis, heart, prostate and peripheral Leukocytes. Lower levels in pancreas and small intestine. A 2.3 kb transcript was also found in peripheral Leukocytes. In brain regions, detected as a 3.0 kb t
Database Links

HGNC: 4482

OMIM: 605187

KEGG: hsa:2850

STRING: 9606.ENSP00000303149

UniGene: Hs.591653

Related Products

GPR27 Antibodies

GPR27 Antibodies for Homo sapiens (Human)

GPR27 Antibodies for Human

GPR27 Proteins

GPR27 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.