Recombinant Human Probable G-protein coupled receptor 34(GPR34)

Code CSB-CF891571HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9UPC5
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTS YSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKW TLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWM LALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIK IGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCY WKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFK PGYSLHDTSVAVKIQSSSKST
Source in vitro E.coli expression system
Gene Names GPR34
Protein Names Recommended name: Probable G-protein coupled receptor 34
Expression Region 1-381
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Broadly expressed.
Database Links

HGNC: 4490

OMIM: 300241

KEGG: hsa:2857

STRING: 9606.ENSP00000367378

UniGene: Hs.495989

Related Products

GPR34 Antibodies

GPR34 Antibodies for Homo sapiens (Human)

GPR34 Antibodies for Human

GPR34 Proteins

GPR34 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.