Recombinant Human Protein-tyrosine sulfotransferase 2(TPST2)

Code CSB-CF024133HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O60704
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS
Source in vitro E.coli expression system
Gene Names TPST2
Protein Names Recommended name: Protein-tyrosine sulfotransferase 2 EC= 2.8.2.20 Alternative name(s): Tyrosylprotein sulfotransferase 2 Short name= TPST-2
Expression Region 1-377
Tag Info 10xHis-SUMO-tag
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides, using 3'-phosphoadenylyl sulfate (PAPS) as cosubstrate.
Subcellular Location Golgi apparatus membrane, Single-pass type II membrane protein
Protein Families Protein sulfotransferase family
Tissue Specificity Widely expressed.
Database Links

HGNC: 12021

OMIM: 603126

KEGG: hsa:8459

STRING: 9606.ENSP00000339813

UniGene: Hs.632768

Related Products

TPST2 Antibodies

TPST2 Antibodies for Homo sapiens (Human)

TPST2 Antibodies for Human

TPST2 Proteins

TPST2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.