Recombinant Human Proto-oncogene Mas(MAS1)

Code CSB-CF013505HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P04201
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFR MRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGL YLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHS RNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIF AMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLT RAFKDEMQPRRQKDNCNTVTVETVV
Source in vitro E.coli expression system
Gene Names MAS1
Protein Names Recommended name: Proto-oncogene Mas
Expression Region 1-325
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for angiotensin 1-7 (By similarity). Acts specifically as a functional antagonist of AGTR1 (angiotensin-2 type 1 receptor), although it up-regulates AGTR1 receptor levels. Positive regulation of AGTR1 levels occurs through activation of the G-proteins GNA11 and GNAQ, and stimulation of the protein kinase C signaling cascade. The antagonist effect on AGTR1 function is probably due to AGTR1 being physically altered by MAS1.
Involvement in disease The MAS oncogene has a weak focus-inducing activity in transfected NIH 3T3 cells.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 6899

OMIM: 165180

KEGG: hsa:4142

STRING: 9606.ENSP00000252660

UniGene: Hs.99900

Pathway Renin-angiotensin system

Q&A and Customer Reviews

Q&A
Q:

I am asking if the recombinante protein cat# CSB-CF013505HU is presented in their natural conformation including glycolisation and others post-translational modifications?
I am also asking if you know if customers have already tested this protein in Biacore technology

A:
Thanks for your inquiry.
Our E.coil cell-free expression system with limited post-translational modifications. The natural conformation of the protein can only be verified by activity testing.
According to our current expression of membrane protein activity test, most of the proteins have activity.
I'm afraid both of the protein hasn't been test in Biacore technology.
Here we attach the product details for your reference:
Recombinant Human Proto-oncogene Mas(MAS1)
CSB-CF013505HU 25-35working days.
Express region:1-325aa,full length protein
Tag information: N-terminal 10xHis-tagged
Sequence:

MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFRMRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGLYLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIFAMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLTRAFKDEMQPRRQKDNCNTVTVETVV

Customer Reviews

Related Products

MAS1 Antibodies

MAS1 Antibodies for Human

MAS1 Antibodies for Homo sapiens (Human)

MAS1 Proteins

MAS1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.