Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF013505HU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P04201 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Sequence | MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFR MRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGL YLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHS RNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIF AMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLT RAFKDEMQPRRQKDNCNTVTVETVV |
| Source | in vitro E.coli expression system |
| Gene Names | MAS1 |
| Protein Names | Recommended name: Proto-oncogene Mas |
| Expression Region | 1-325 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | Full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Receptor for angiotensin 1-7 (By similarity). Acts specifically as a functional antagonist of AGTR1 (angiotensin-2 type 1 receptor), although it up-regulates AGTR1 receptor levels. Positive regulation of AGTR1 levels occurs through activation of the G-proteins GNA11 and GNAQ, and stimulation of the protein kinase C signaling cascade. The antagonist effect on AGTR1 function is probably due to AGTR1 being physically altered by MAS1. |
| Involvement in disease | The MAS oncogene has a weak focus-inducing activity in transfected NIH 3T3 cells. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 1 family |
| Database Links |
HGNC: 6899 OMIM: 165180 KEGG: hsa:4142 STRING: 9606.ENSP00000252660 UniGene: Hs.99900 |
| Pathway | Renin-angiotensin system |
I am asking if the recombinante protein cat# CSB-CF013505HU is presented in their natural conformation including glycolisation and others post-translational modifications?
I am also asking if you know if customers have already tested this protein in Biacore technology
MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFRMRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGLYLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIFAMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLTRAFKDEMQPRRQKDNCNTVTVETVV
MAS1 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA013505ESR2HU | MAS1 Antibody | Human | ELISA, IHC |
| CSB-PA013505LA01HU | MAS1 Antibody | Human | ELISA, WB, IHC, IF |
| CSB-PA013505LB01HU | MAS1 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA013505LC01HU | MAS1 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA013505LD01HU | MAS1 Antibody, Biotin conjugated | Human | ELISA |
MAS1 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA080177 | MAS1 Antibody | Human,Mouse,Rat | WB,IHC |
| CSB-PA084695 | MAS1 Antibody | Human,Mouse,Rat | ELISA,IHC |
MAS1 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP013505HU1 CSB-EP013505HU1 CSB-BP013505HU1 CSB-MP013505HU1 |
Recombinant Human Proto-oncogene Mas(MAS1), partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Methylmalonyl-CoA mutase, mitochondrial(MMUT)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Lysosomal acid Glucosylceramidase(Gba)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Pyruvate kinase isozymes R/L(PKLR)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Transcriptional coactivator YAP1(YAP1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rat Thyrotropin subunit beta(Tshb)
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Mouse Superoxide dismutase [Cu-Zn](Sod1)
Express system: E.coli
Species: Mus musculus (Mouse)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.