Recombinant Human RING finger protein 26(RNF26)

Code CSB-CF019883HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9BY78
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MEAVYLVVNGLGLVLDVLTLVLDLNFLLVSSLLASLAWLLAFVYNLPHTVLTSLLHLGRG VLLSLLALIEAVVRFTCGGLQALCTLLYSCCSGLESLKLLGHLASHGALRSREILHRGVL NVVSSGHALLRQACDICAIAMSLVAYVINSLVNICLIGTQNLFSLVLALWDAVTGPLWRM TDVVAAFLAHISSSAVAMAILLWTPCQLALELLASAARLLASFVLVNLTGLVLLACVLAV TVTVLHPDFTLRLATQALSQLHARPSYHRLREDVMRLSRLALGSEAWRRVWSRSLQLASW PNRGGAPGAPQGDPMRVFSVRTRRQDTLPEAGRRSEAEEEEARTIRVTPVRGRERLNEEE PPGGQDPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPL CRRGILQTLNVYL
Source in vitro E.coli expression system
Gene Names RNF26
Protein Names Recommended name: RING finger protein 26
Expression Region 1-433
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function E3 ubiquitin-protein ligase that plays a key role in endosome organization by retaining vesicles in the perinuclear cloud
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Tissue Specificity Ubiquitous. Up-regulated in several cancer cell lines.
Database Links

HGNC: 14646

OMIM: 606130

KEGG: hsa:79102

UniGene: Hs.524084

Related Products

RNF26 Antibodies

RNF26 Antibodies for Human

RNF26 Proteins

RNF26 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.