Recombinant Human Serine protease hepsin(HPN)

Code CSB-CF010704HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P05981
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDR
Source in vitro E.coli expression system
Gene Names HPN
Protein Names Recommended name: Serine protease hepsin EC= 3.4.21.106 Alternative name(s): Transmembrane protease serine 1 Cleaved into the following 2 chains: 1. Serine protease hepsin non-catalytic chain 2. Serine protease hepsin catalytic chain
Expression Region 1-162
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Serine protease that cleaves extracellular substrates, and contributes to the proteolytic processing of growth factors, such as HGF and MST1/HGFL
Subcellular Location Cell membrane, Single-pass type II membrane protein, Apical cell membrane, Single-pass type II membrane protein
Protein Families Peptidase S1 family
Tissue Specificity Detected in liver and kidney.
Database Links

HGNC: 5155

OMIM: 142440

KEGG: hsa:3249

STRING: 9606.ENSP00000262626

UniGene: Hs.182385

Related Products

HPN Antibodies

HPN Antibodies for Homo sapiens (Human)

HPN Antibodies for Human

HPN Proteins

HPN Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.