Recombinant Human Serine protease hepsin (HPN)

Code CSB-CF010704HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
HPN
Uniprot No.
Alternative Names
HPN; TMPRSS1; Serine protease hepsin; Transmembrane protease serine 1
Species
Homo sapiens (Human)
Expression Region
1-417
Target Protein Sequence
MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serine protease that cleaves extracellular substrates, and contributes to the proteolytic processing of growth factors, such as HGF and MST1/HGFL. Plays a role in cell growth and maintenance of cell morphology. Plays a role in the proteolytic processing of ACE2. Mediates the proteolytic cleavage of urinary UMOD that is required for UMOD polymerization.
Gene References into Functions
  1. Study showed was that Hepsin was downregulated in 78% of gastric cancer. Its high expression seems to predict poor prognosis. These results predicted that hepsin protein expression was one of the significant and independent prognostic factors for overall survival of Gastric Cancer. PMID: 27841306
  2. Genetic variation in/near the gene encoding for hepsin protein may influence risk of bipolar disorder and (at least for the rs62122114-A allele) may have functional impact (i.e. differential expression) as evidenced by serum HPN protein expression. PMID: 28886448
  3. significant negative association was found between hepsin expression in endometrial carcinoma cases regarding the grade and the size of tumors as well as myometrial invasion PMID: 26990747
  4. These data demonstrate that the membrane-bound serine protease hepsin is the enzyme responsible for the physiological cleavage of uromodulin. PMID: 26673890
  5. The Hepsin pathway acts in concert with Wnt pathway to promote prostate cancer progression. PMID: 26139199
  6. Low expression levels of hepsin and TMPRSS3 are associated with poor breast cancer survival PMID: 26014348
  7. Hepsin suppressed CDK11p58 internal ribosome entry site activity in prostate cancer cells by modulating UNR expression and eIF-2alpha phosphorylation. PMID: 25576733
  8. The results of this study suggest that, in Korean men, some polymorphisms in the HPN gene might be associated with the risk of developing prostate cancer. PMID: 22665141
  9. hepsin expression is frequently up-regulated in breast cancer tissues, which is associated with tumor growth and progression PMID: 21383634
  10. These findings suggest that the MSP/RON signaling pathway may be regulated by hepsin in tissue homeostasis and in disease pathologies, such as in cancer and immune disorders. PMID: 21875933
  11. Elevated levels of hepsin interfere with cell adhesion and viability in the background of prostate cancer as well as other tissue types, the details of which depend on the microenvironment provided. PMID: 21750652
  12. Hepsin activity was inhibited by anthralin and increased by resveratrol. PMID: 20673210
  13. Germline genetic variation of HPN does not seem to contribute to risk of prostate cancer or prognosis. PMID: 20166135
  14. Hepsin activates prostasin and cleaves the extracellular domain of the epidermal growth factor receptor. PMID: 19911255
  15. Hepsin and maspin are inversely expressed in laser capture microdissectioned prostate cancer PMID: 12629351
  16. Hepsin is functionally linked to hepatocyte growth factor/MET pathway, which may contribute to prostate cancer progression. PMID: 15792801
  17. A major 11-locus haplotype is significantly associated with prostate cancer, which provides further support that HPN is a potentially important candidate gene involved in prostate cancer susceptibility. PMID: 16783571
  18. the ability of hepsin to efficiently activate pro-uPA suggests that it may initiate plasmin-mediated proteolytic pathways at the tumor/stroma interface that lead to basement membrane disruption and tumor progression PMID: 16908524
  19. Our findings suggest that the balance between hepsin and its inhibitor, HAI-2, may have prognostic value in RCC. PMID: 17309599
  20. We analyzed all the common variations using tag SNP in the HPN and LTBP4 genes for association with IA in 390 patients and 642 controls in the Dutch population. PMID: 18487557
  21. Hepsin showed potential inhibitory effects mediated by the induction of 14-3-3sigma expression which leads to both cell cycle arrest at the G2/M phase PMID: 18698500
  22. Ln-332 may be one mechanism by which hepsin promotes prostate tumor progression and metastasis, possibly by up-regulating prostate cancer cell motility. PMID: 18784072

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein. Apical cell membrane; Single-pass type II membrane protein.
Protein Families
Peptidase S1 family
Tissue Specificity
Detected in liver and kidney.
Database Links

HGNC: 5155

OMIM: 142440

KEGG: hsa:3249

STRING: 9606.ENSP00000262626

UniGene: Hs.182385

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1