Recombinant Human Solute carrier family 22 member 3 (SLC22A3)

Code CSB-CF021458HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SLC22A3
Uniprot No.
Alternative Names
SLC22A3; EMTH; OCT3; Solute carrier family 22 member 3; Extraneuronal monoamine transporter; EMT; Organic cation transporter 3
Species
Homo sapiens (Human)
Expression Region
1-556
Target Protein Sequence
MPSFDEALQRVGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGTQPDHYWCRGPSAAALA ERCGWSPEEEWNRTAPASRGPEPPERRGRCQRYLLEAANDSASATSALSCADPLAAFPNR SAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYG RIVIYLLSCLGVGVTGVVVAFAPNFPVFVIFRFLQGVFGKGTWMTCYVIVTEIVGSKQRR IVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKK GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFT SAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVA CLVTAFLPEGIAWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFG GIIAPFLLFRLAAVWLELPLIIFGILASICGGLVMLLPETKGIALPETVDDVEKLGSPHS CKCGRNKKTPVSRSHL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates potential-dependent transport of a variety of organic cations. May play a significant role in the disposition of cationic neurotoxins and neurotransmitters in the brain.
Gene References into Functions
  1. Data show that the common variation in the solute carrier family 22 member 3 (SLC22A3) gene is unlikely to significantly contribute to pancreatic cancer risk, and the rs2504938 single nucleotide polymorphism (SNP) in SLC22A3 significantly associates with an unfavorable prognosis of pancreatic cancer patients. PMID: 28272475
  2. SNPs in SLC22A3 and H3F3B may influence lipid levels through altering the expression of local genes. PMID: 29894858
  3. A-to-I RNA editing of SLC22A3 contributes to the early development and progression of familial esophageal squamous cell carcinoma in high-risk individuals. PMID: 28533408
  4. our study suggests that several PHACTR1 and SLC22A3 gene polymorphisms may exert a protective effect against the CAD in the Chinese Han male population. PMID: 27893421
  5. SLC22A3 deletion is associated with motor speech disorders, and language delays. PMID: 28767196
  6. may be a regulator of the concentration of norepinephrine in adipose tissue. PMID: 28034777
  7. the rs3088442G>A variant as a genetic marker may potentially assist in the identification of individuals at an increased risk of T2D. PMID: 28625319
  8. The genotype of rs3088442 within the SLC22A3-LPAL2-LPA gene cluster may contribute to regulation of plasma Lp(a) levels and possibly to the severity of coronary artery disease in a Chinese Han population. PMID: 27417586
  9. Findings suggest that OCT3 plays an important role in the absorption and elimination of metformin and that the transporter is a critical determinant of metformin bioavailability, clearance, and pharmacologic action. PMID: 25920679
  10. The markers of EMT were detected by using Western blot. PMID: 25322669
  11. Findings suggest a negative feedback mechanism against inflammatory response by which solute carrier family 22 member 3 (SLC22A3) variant rs3088442 G-->A decreased the risk of coronary heart disease (CHD). PMID: 25561729
  12. Cultured astroctye line 1321N1 and primary human astrocytes transport monoamines partly through OCT3. PMID: 24471494
  13. There was no association between rs7758229 in 6q26-q27/SLC22A3 and the risk of colorectal cancer in a Chinese population. PMID: 23555006
  14. Decreasing expression of OCT3 and MATE1 in human placenta indicates these transporters may play a role in fetal protection preferentially at earlier stages of gestation. PMID: 23303678
  15. Our studies demonstrate that genetic polymorphisms in the proximal promoter region of OCT3 alter the transcription rate of the gene and may be associated with altered expression levels of OCT3 in human liver. PMID: 22231567
  16. The increased Wnt3 in the trastuzumab-resistant cells also promoted a partial EMT-like transition. PMID: 23071104
  17. PDLIM5 (rs17021918,T), SLC22A3 (rs9364554,C) and NKX3-1 (rs1512268,A) SNPs might not be associated with prostate cancer in Chinese men. PMID: 22741436
  18. The risk for coronary artery disease in a Chinese Han population is not associated with single nucleotide polymorphisms in the SLC22A3-LPAL2-LPA gene cluster. PMID: 23036009
  19. NUDT11, HNF1B, and SLC22A3 genes have roles in prostate cancer pathogenesis PMID: 22730461
  20. SLC22A3 was expressed high in the human heart with strongest OCT3 immunoreactivity in vascular endothelial cells. SLC22A3/OCT3 expression was not changed in failing human left ventricular myocardium PMID: 21697722
  21. OCT3 overexpression significantly increased cisplatin cellular accumulation and cytotoxicity in KB-3-1 cells. PMID: 21905038
  22. evidence for a new means of downregulating IL-4 production by basophils, both in vitro and in vivo, through OCT3 targeted by 5-HT and pharmacologic ligands. PMID: 21636115
  23. Genetic association studies indicate 5 SNPs are associated with reduced transport activity of OCT3 (using 5-HT & MPP). PMID: 20562519
  24. The regulation of EMT-mediated transport by second-messenger phosphorylation/dephosphorylation mechanisms has been characterized in stably transfected HEK293 cells with tritiated 1-methyl-4-phenylpyridinium as substrate. PMID: 11770002
  25. EMT efficiently translocates agmatine and must be considered for the control of agmatine levels. PMID: 12538837
  26. Genetic variation of EMT was studied in Caucasians. PMID: 12768439
  27. EMT is expressed in the area postrema of rat brain and may play a role in physiological functions of this circumventricular organ such as emesis, food intake and the regulation of cardiovascular functions. PMID: 14690517
  28. organic cation transporter EMT mRNA was mainly detected in the intra lobular septa and also expressed in scattered cells of placental vessel adventitias with lower expression of EMT mRNAs in pre-eclamptic placentae PMID: 15135235
  29. Ranitidine and famotidine elicited differential inhibitory activities on SLC22A3. PMID: 16141367
  30. These results suggest that polymorphisms of SLC22A3 are related to the development of polysubstance use in Japanese patients with methamphetamine (MAP) dependence. PMID: 17010131
  31. PMAT, EMT, and OCT2 transporters are expressed in the endometrial stroma and can potentially regulate reuptake of monoamines in general and histamine in particular. PMID: 17393420
  32. rare mutations in the EMT gene suggest a causative or modulating role in genetic subtypes of obsessive-compulsive disorder PMID: 17477885
  33. Confirm the usefulness of Caki-1 cells as a proximal tubule model system for investigations of OCT3. PMID: 18253050
  34. We conclude that the proliferation of immature germ cells in GB may be due to an interaction between OCT3/4 and accumulated beta-catenin in the nuclei of the immature germ cells. PMID: 18295396
  35. Identification of the SLC22A3-LPAL2-LPA gene cluster as a strong susceptibility locus for coronary artery disease. PMID: 19198611

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family
Tissue Specificity
Expressed in placenta, skeletal muscle, prostate, aorta, liver, fetal lung, salivary gland, adrenal gland, kidney and brain cortex. No expression detected in spleen.
Database Links

HGNC: 10967

OMIM: 604842

KEGG: hsa:6581

STRING: 9606.ENSP00000275300

UniGene: Hs.567337

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X