Recombinant Human Somatostatin receptor type 4 (SSTR4)

Code CSB-CF022727HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SSTR4
Uniprot No.
Alternative Names
SSTR4; Somatostatin receptor type 4; SS-4-R; SS4-R; SS4R
Species
Homo sapiens (Human)
Expression Region
1-388
Target Protein Sequence
MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM CPPLPCQQEALQPEPGRKRIPLTRTTTF
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. It is functionally coupled not only to inhibition of adenylate cyclase, but also to activation of both arachidonate release and mitogen-activated protein (MAP) kinase cascade. Mediates antiproliferative action of somatostatin in tumor cells.
Gene References into Functions
  1. deregulated somatostatin signaling in the Alzheimer disease cortices studied cannot be explained by hypermethylation of the SST or SSTR4 promoter CpG islands. PMID: 24602981
  2. this study shows that CD26 is associated with SSTR4 in malignant pleural mesothelioma cells, and this interaction inhibits SSTR4-mediated cytostatic effects. PMID: 24743707
  3. High SSTR4 expression is associated with lymph node metastasis in gallbladder cancer. PMID: 23991955
  4. Evaluation of the potential use of sst5TMD4 expression in surgically removed pituitary adenomas as a predictor of the subsequent response of different pituitary tumors to somatostatin therapy. PMID: 20233783
  5. In somatotrophinomas patients treated with somatostatin analogs, the most expressed SSTR was SSTR5, SSTR3, SSTR2, SSTR1, and SSTR4, respectively. PMID: 19330452
  6. expression of SSTR4 transcripts up-regulated in prostatic carcinoma cells; SSTR4 agonists may have role in treatment of prostate cancer PMID: 12210479
  7. A variable degree of SSTR4 was detected in laryngeal benign, premalignant and malignant specimens, with the greatest percentage in teh malignant specimens. PMID: 18066572
  8. Immunohistochemistry stufy of SSTR4 in prostate tissue from patients with bladder outlet obstruction showed that close to 90% of secretory cells showed a weak positivity in the cytoplasm. PMID: 18936524
  9. Heterodimerization between somatostatin receptor 4 and somatostatin receptor 5 exerted receptor and ligand specific changes in receptor coupling to adenylyl cyclase and the downstream signaling pathway. PMID: 19426801
  10. the expression, localization, and inflammation-induced alterations of sst(4) receptors in murine and human lungs PMID: 19687471

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Specifically expressed in fetal and adult brain, lung tissue, stomach, and in lesser quantities in the kidney, pituitary and adrenals.
Database Links

HGNC: 11333

OMIM: 182454

KEGG: hsa:6754

STRING: 9606.ENSP00000255008

UniGene: Hs.673846

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1