Recombinant Human Sphingosine 1-phosphate receptor 5 (S1PR5)

Code CSB-CF867132HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
S1PR5; EDG8; Sphingosine 1-phosphate receptor 5; S1P receptor 5; S1P5; Endothelial differentiation G-protein-coupled receptor 8; Sphingosine 1-phosphate receptor Edg-8; S1P receptor Edg-8
Species
Homo sapiens (Human)
Expression Region
1-398
Target Protein Sequence
MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins. May play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.
Gene References into Functions
  1. Reduced DNA methylation may underlie the increased expression of the S1PR5 gene in alveolar macrophages and associated defective efferocytosis in COPD. PMID: 27868302
  2. Data indicate that the mitotic kinase Polo-like kinase 1 (PLK1) was an important effector of S1P-S1P5 signaling, and a new function of the SphK1-S1P pathway specifically in the control of mitosis in HeLa cells. PMID: 28351953
  3. TGF-beta2 dependent upregulation of S1P5 is required for the induction of pro-fibrotic CTGF by TGF-beta in mesangial cells. PMID: 25601519
  4. This report is the first to demonstrate a reduction in S1P5 in multiple sclerosis lesions, which parallels that of myelin loss. PMID: 23551178
  5. Data show that sphingosine kinase SphK1 and sphingosine-1-phosphate (S1P) receptors S1P1, S1P2, S1P3, and S1P5 were expressed from primary, up to recurrent and secondary glioblastomas, with sphingosine kinase SphK2 levels were highest in primary tumors. PMID: 24903384
  6. Edg-5 receptor in brain endothelial cells contributes to optimal barrier formation and maintenance of immune quiescence of the barrier endothelium. PMID: 22715976
  7. The decreased expression level of S1PR5 on NK cells is associated with graft versus host disease occurrence after allogeneic hematopoietic stem cell transplantation. PMID: 22541110
  8. The molecular identity, functional properties, and expression profile of the S1P5 (Edg-8) receptor have been characterized. PMID: 11705398
  9. differences between hS1P(5) and rS1P(5) will be an important point to be considered in the development of selective receptor antagonists. PMID: 12234605
  10. identify and characterize the gene; describe its expression in normal tissues and large granular lymphocyte leukemia monocytes PMID: 12427546
  11. FTY720 induces time-dependent modulation of S1P receptors on human OPCs with consequent functional responses that are directly relevant for the remyelination process. PMID: 17918267
  12. The centrosomal sphingosine-1-phosphate receptor 5 might function as an intracellular target of sphingosine-1-phosphate linked to regulation of mitosis. PMID: 19211033
  13. Results suggest that, under serum-starved conditions, sphingosine 1-phosphate (S1P) further upregulates autophagic activity through S1P(5)-dependent pathways in PC-3 cells. PMID: 19474291

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Widely expressed in the brain, most prominently in the corpus callosum, which is predominantly white matter. Detected in spleen, peripheral blood leukocytes, placenta, lung, aorta and fetal spleen. Low-level signal detected in many tissue extracts. Overex
Database Links

HGNC: 14299

OMIM: 605146

KEGG: hsa:53637

STRING: 9606.ENSP00000328472

UniGene: Hs.501561

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1