Product Details

Target Names

TUSC3

Uniprot No.

Alternative Names

TUSC3; N33; Tumor suppressor candidate 3; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TUSC3; Oligosaccharyl transferase subunit TUSC3; Magnesium uptake/transporter TUSC3; Protein N33

Species

Homo sapiens (Human)

Expression Region

42-348

Target Protein Sequence

QKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSV CRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPK RADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNN LEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAES HIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYP YSDLDFE

Protein Length

Full Length of Mature Protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

Acts as accessory component of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Involved in N-glycosylation of STT3B-dependent substrates. Specifically required for the glycosylation of a subset of acceptor sites that are near cysteine residues; in this function seems to act redundantly with MAGT1. In its oxidized form proposed to form transient mixed disulfides with a glycoprotein substrate to facilitate access of STT3B to the unmodified acceptor site. Has also oxidoreductase-independent functions in the STT3B-containing OST complex possibly involving substrate recognition.; Magnesium transporter.

Gene References into Functions

miR-UL112-3p exerts its oncogene function by directly targeting TUSC3 in Glioblastoma. PMID: 28303930
study demonstrated an oncogenic role of TUSC3 in Non-small cell lung cancer and showed that dis-regulation of TUSC3 may affect tumour cell invasion and migration through possible involvement in the Hedgehog (Hh) signalling pathway. PMID: 28487226
TUSC3 may act as an oncogene in the progression of colorectal cancer. PMID: 30115537
TUSC3 can function both as an oncogene and as a tumor suppressor. (Review) PMID: 28929175
our data indicate that miR-132 induces temozolomide resistance and promotes the formation of cancer stem cell phenotypes by targeting TUSC3 in glioblastoma. PMID: 28901390
This paper supports the previous clinical descriptions of the condition caused by TUSC3 mutations and describes the seventh family with mutations in this gene, thus contributing to the genetic spectrum of mutations. This is the first report of a family from the Arabian peninsula with this form of Intellectual disability . PMID: 27148795
SOX2 regulates the proliferation, migration and invasiveness of breast cancer cells through miR-181a-5p and miR-30e-5p which modulate TUSC3 protein levels PMID: 28288641
Decreased Tumor Suppressor Candidate 3 Predicts Poor Prognosis of Patients with Esophageal Squamous Cell Carcinoma PMID: 27994502
TUSC3 regulates proliferation and invasion of glioblastoma cells by inhibiting the activity of the Akt signaling pathway. PMID: 27177902
decreased immunological TUSC3 staining is a factor prognostic of poor survival in pancreatic cancer patients. PMID: 26871953
The TUSC3 gene is associated with mental retardation in the Qinba mountain area in China; the sixth exon of the TUSC3 gene may contribute to the risk of developing the disease. PMID: 25966277
Report frequencies of short tandem repeat markers linked to TUSC3 (MRT7) or NSUN2 (MRT5) genes used for homozygosity mapping of recessive intellectual disability. PMID: 26427135
TUSC3 loss alters the ER stress response and accelerates prostate cancer growth in vivo PMID: 24435307
Loss of TUSC3 alters the molecular response to endoplasmic reticulum stress. PMID: 25735931
IGFII and N33 methylation status may be related to gastric carcinogenesis. PMID: 25086101
TUSC3 increases glycosylation efficiency for a subset of human glycoproteins by slowing glycoprotein folding. PMID: 24685145
Homozygous deletion in TUSC3 causes syndromic intellectual disability. PMID: 23825019
TUSC3 is a tumor suppressor gene in ovarian cancer. PMID: 23404293
Genotyping and linkage analysis excluded linkage of the GRIK2 gene and TUSC3 gene with mental retardation. PMID: 21557188
A novel nonsense mutation in TUSC3 is responsible for non-syndromic autosomal recessive mental retardation PMID: 21739581
analysis of a novel deletion mutation in the TUSC3 gene in a consanguineous Pakistani family that may have a role in autosomal recessive nonsyndromic intellectual PMID: 21513506
These findings suggest that inactivation through methylation of the putative tumor suppressor genes N-33 may not be associated with colorectal carcinogenesis in UC. PMID: 20505342
Down regulated in ovarian cancer or absent in ovarian cancer and impact survival. PMID: 16270321
N33, STK11 (19p13) and TP53 might play a role in the development of metastasis in larynx and pharynx squamous cell carcinomas. PMID: 17641416
TUSC3 is only the fifth gene implicated in NS-ARMR and the first for which mutations have been reported in more than one family. PMID: 18452889
study shows that mutations in two OTase-subunit genes, N33/TUSC3 and IAP result in autosomal-recessive nonsyndromic mental retardation PMID: 18455129
Knockdown of either MagT1 or TUSC3 protein significantly lowers the total and free intracellular Mg(2+) concentrations in cell lines. PMID: 19717468

Hide All

Involvement in disease

Mental retardation, autosomal recessive 7 (MRT7)

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein.

Protein Families

OST3/OST6 family

Tissue Specificity

Expressed in most non-lymphoid cells and tissues examined, including prostate, lung, liver, colon, heart, kidney and pancreas.

Database Links

HGNC: 30242

OMIM: 601385

KEGG: hsa:7991

STRING: 9606.ENSP00000221167

UniGene: Hs.426324

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF025352HU
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Tumor suppressor candidate 3 (TUSC3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage