Recombinant Human Tumor suppressor candidate 3 (TUSC3)

Code CSB-CF025352HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
TUSC3; N33; Tumor suppressor candidate 3; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TUSC3; Oligosaccharyl transferase subunit TUSC3; Magnesium uptake/transporter TUSC3; Protein N33
Species
Homo sapiens (Human)
Expression Region
42-348
Target Protein Sequence
QKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSV CRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPK RADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNN LEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAES HIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYP YSDLDFE
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as accessory component of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Involved in N-glycosylation of STT3B-dependent substrates. Specifically required for the glycosylation of a subset of acceptor sites that are near cysteine residues; in this function seems to act redundantly with MAGT1. In its oxidized form proposed to form transient mixed disulfides with a glycoprotein substrate to facilitate access of STT3B to the unmodified acceptor site. Has also oxidoreductase-independent functions in the STT3B-containing OST complex possibly involving substrate recognition.; Magnesium transporter.
Gene References into Functions
  1. miR-UL112-3p exerts its oncogene function by directly targeting TUSC3 in Glioblastoma. PMID: 28303930
  2. study demonstrated an oncogenic role of TUSC3 in Non-small cell lung cancer and showed that dis-regulation of TUSC3 may affect tumour cell invasion and migration through possible involvement in the Hedgehog (Hh) signalling pathway. PMID: 28487226
  3. TUSC3 may act as an oncogene in the progression of colorectal cancer. PMID: 30115537
  4. TUSC3 can function both as an oncogene and as a tumor suppressor. (Review) PMID: 28929175
  5. our data indicate that miR-132 induces temozolomide resistance and promotes the formation of cancer stem cell phenotypes by targeting TUSC3 in glioblastoma. PMID: 28901390
  6. This paper supports the previous clinical descriptions of the condition caused by TUSC3 mutations and describes the seventh family with mutations in this gene, thus contributing to the genetic spectrum of mutations. This is the first report of a family from the Arabian peninsula with this form of Intellectual disability . PMID: 27148795
  7. SOX2 regulates the proliferation, migration and invasiveness of breast cancer cells through miR-181a-5p and miR-30e-5p which modulate TUSC3 protein levels PMID: 28288641
  8. Decreased Tumor Suppressor Candidate 3 Predicts Poor Prognosis of Patients with Esophageal Squamous Cell Carcinoma PMID: 27994502
  9. TUSC3 regulates proliferation and invasion of glioblastoma cells by inhibiting the activity of the Akt signaling pathway. PMID: 27177902
  10. decreased immunological TUSC3 staining is a factor prognostic of poor survival in pancreatic cancer patients. PMID: 26871953
  11. The TUSC3 gene is associated with mental retardation in the Qinba mountain area in China; the sixth exon of the TUSC3 gene may contribute to the risk of developing the disease. PMID: 25966277
  12. Report frequencies of short tandem repeat markers linked to TUSC3 (MRT7) or NSUN2 (MRT5) genes used for homozygosity mapping of recessive intellectual disability. PMID: 26427135
  13. TUSC3 loss alters the ER stress response and accelerates prostate cancer growth in vivo PMID: 24435307
  14. Loss of TUSC3 alters the molecular response to endoplasmic reticulum stress. PMID: 25735931
  15. IGFII and N33 methylation status may be related to gastric carcinogenesis. PMID: 25086101
  16. TUSC3 increases glycosylation efficiency for a subset of human glycoproteins by slowing glycoprotein folding. PMID: 24685145
  17. Homozygous deletion in TUSC3 causes syndromic intellectual disability. PMID: 23825019
  18. TUSC3 is a tumor suppressor gene in ovarian cancer. PMID: 23404293
  19. Genotyping and linkage analysis excluded linkage of the GRIK2 gene and TUSC3 gene with mental retardation. PMID: 21557188
  20. A novel nonsense mutation in TUSC3 is responsible for non-syndromic autosomal recessive mental retardation PMID: 21739581
  21. analysis of a novel deletion mutation in the TUSC3 gene in a consanguineous Pakistani family that may have a role in autosomal recessive nonsyndromic intellectual PMID: 21513506
  22. These findings suggest that inactivation through methylation of the putative tumor suppressor genes N-33 may not be associated with colorectal carcinogenesis in UC. PMID: 20505342
  23. Down regulated in ovarian cancer or absent in ovarian cancer and impact survival. PMID: 16270321
  24. N33, STK11 (19p13) and TP53 might play a role in the development of metastasis in larynx and pharynx squamous cell carcinomas. PMID: 17641416
  25. TUSC3 is only the fifth gene implicated in NS-ARMR and the first for which mutations have been reported in more than one family. PMID: 18452889
  26. study shows that mutations in two OTase-subunit genes, N33/TUSC3 and IAP result in autosomal-recessive nonsyndromic mental retardation PMID: 18455129
  27. Knockdown of either MagT1 or TUSC3 protein significantly lowers the total and free intracellular Mg(2+) concentrations in cell lines. PMID: 19717468

Show More

Hide All

Involvement in disease
Mental retardation, autosomal recessive 7 (MRT7)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
OST3/OST6 family
Tissue Specificity
Expressed in most non-lymphoid cells and tissues examined, including prostate, lung, liver, colon, heart, kidney and pancreas.
Database Links

HGNC: 30242

OMIM: 601385

KEGG: hsa:7991

STRING: 9606.ENSP00000221167

UniGene: Hs.426324

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1