Recombinant Human Vesicle-associated membrane protein-associated protein B/C(VAPB)

Code CSB-CF025790HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O95292
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL
Source in vitro E.coli expression system
Gene Names VAPB
Protein Names Recommended name: Vesicle-associated membrane protein-associated protein B/C Short name= VAMP-B/VAMP-C Short name= VAMP-associated protein B/C Short name= VAP-B/VAP-C
Expression Region 2-243
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation.
Involvement in disease Amyotrophic lateral sclerosis 8 (ALS8); Spinal muscular atrophy, proximal, adult, autosomal dominant (SMAPAD)
Subcellular Location Endoplasmic reticulum membrane, Single-pass type IV membrane protein
Protein Families VAMP-associated protein (VAP) (TC 9.B.17) family
Tissue Specificity Ubiquitous. Isoform 1 predominates.
Database Links

HGNC: 12649

OMIM: 182980

KEGG: hsa:9217

STRING: 9606.ENSP00000417175

UniGene: Hs.182625

Pathway Cholesterol metabolism

Related Products

VAPB Antibodies

VAPB Antibodies for Homo sapiens (Human)

VAPB Antibodies for Human

VAPB Proteins

VAPB Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.