Recombinant Macaca fascicularis P2Y purinoceptor 12(P2RY12)

Code CSB-CF839200MOV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q95KC3
Storage Buffer Tris-based buffer,50% glycerol
Species Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Sequence MQAIDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNSLAMRIFFQIRSKSNFI IFLKNTVISDLLMILTFPFKILSDAKLGAGPLRTFVCQVTSVIFYFTMYISISFLGLITI DRYQKTTRPFKTSNPKNLLGAKILSVLIWAFMFLLSLPNMILTNRRPRDKNVKKCSFLKS EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI IIAVFFICFVPFHFARIPYTLSQTRDVFDCAAENTLFYVKESTLWLTSLNACLDPFIYFF LCKSFRNSLISMLKCPNSATSQSQDNRKKEQDGGDPNEETPM
Source in vitro E.coli expression system
Gene Names P2RY12
Protein Names Recommended name: P2Y purinoceptor 12 Short name= P2Y12
Expression Region 1-342
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Required for normal platelet aggregation and blood coagulation (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

UniGene: Mfa.318

Related Products

P2RY12 Proteins

P2RY12 Proteins for Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.