Recombinant Mouse 5-hydroxytryptamine receptor 1B (Htr1b)

Code CSB-CF010882MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Htr1b; 5ht1b; 5-hydroxytryptamine receptor 1B; 5-HT-1B; 5-HT1B; Serotonin receptor 1B
Species
Mus musculus (Mouse)
Expression Region
1-386
Target Protein Sequence
MEEQGIQCAPPPPAASQTGVPLTNLSHNCSADGYIYQDSIALPWKVLLVALLALITLATT LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF WLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVLVWVFSISISLPP FFWRQAKAEEEMLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP NKTGKRLTRAQLITDSPGSTSSVTSINSRAPDVPSESGSPVYVNQVKVRVSDALLEKKKL MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI NPIIYTMSNEDFKQAFHKLIRFKCAG
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various alkaloids and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Regulates the release of 5-hydroxytryptamine, dopamine and acetylcholine in the brain, and thereby affects neural activity, nociceptive processing, pain perception, mood and behavior. Besides, plays a role in vasoconstriction of cerebral arteries.
Gene References into Functions
  1. Consistent with previous studies that have optogenetically inhibited vHPC-mPFC projections, activating prefrontal 5-HT1B receptors suppressed theta-frequency mPFC activity (4-12 Hz), and reduced avoidance of anxiogenic regions in the elevated plus maze PMID: 27974203
  2. Mice lacking 5-HT1B autoreceptors displayed the expected increases in extracellular serotonin levels in the ventral hippocampus following administration of a selective serotonin reuptake inhibitor. PMID: 27353308
  3. 5-HT1B receptor-dependent cellular Src-related kinase-Nox1-pathways contribute to vascular remodeling in pulmonary arterial hypertension. PMID: 28473438
  4. 5-HT1B Knockout and pharmacologic 5-HT1B antagonism both attenuated locomotor hyperactivity in dopamine transporter Knockout mice. PMID: 25514162
  5. 5-HT1BR was validated as a target for miRNA-96. Transfection of precursor miRNA-96 into hPASMCs reduced 5-HT1BR expression and inhibited serotonin-induced proliferation in pulmonary hypertension development. PMID: 25871906
  6. The data of this study showed that while adolescent expression of 5-HT1BRs influences aggressive behavior, a distinct set of 5-HT1B receptors modulates impulsive behavior during adulthood. PMID: 25892302
  7. 5-HT(1B)R stimulation increased glutamatergic neurotransmission in the hippocampus in p11KO mice, but not in WT mice. Hippocampal p11 determines the directionality of 5-HT(1B)R action on emotional memory processing PMID: 23032875
  8. Selective inhibition of 5-HT2A by sarpogrelate stimulated angiogenesis, restoring ischemic limb blood perfusion in a severe diabetic mouse model through stimulation of the eNOS/Akt pathway via the endothelial 5-HT1B receptor. PMID: 22172591
  9. Data indicate that most p11 expressing cells in cerebral cortex, hippocampus, cerebellum, & caudate-putamen express HTR1B or co-express HTR1B/HTR4, suggesting crucial role for p11 in modulating actions of serotonin via these receptor subtypes. PMID: 21300076
  10. In the developing barrel field of the neonatal mice 5-HT1B receptors mediate an activity-dependent regulation of the thalamocortical EPSC that could favor the propagation of high-frequency thalamocortical activity PMID: 11826118
  11. 5-Hydroxytryptamine(1B/1D) receptors inhibit capsaicin-induced c-fos immunoreactivity within mouse trigeminal nucleus caudalis. PMID: 12110114
  12. endogenous activation of 5-HT1B presynaptic receptors modulates circadian behavior by attenuating photic input to the suprachiasmatic nucleus PMID: 12375619
  13. The influence of the pre- and postweaning maternal environment on the offspring's phenotype was examined in 5-HT1A and 5-HT1B receptor knockout mice (KO1A and KO1B, respectively. PMID: 12555283
  14. Serotonin 1B receptor gene deletion selectively enhances learning performance when the cognitive requirement of the task is elevated. PMID: 12565126
  15. 5-HT(1B) receptors appear to play an important role in impulsivity and a minor role in prefrontal cortex-dependent learning and memory as shown by the results obtained in serial reversal learning and extinction PMID: 12742250
  16. Delay-dependent working memory is impaired in young-adult and aged 5-HT1B knockout mice PMID: 14557613
  17. These studies revealed a beneficial effect of the mutation on the acquisition of a spatial reference memory task, but a deleterious effect on a working memory task for long delays. PMID: 14657258
  18. Presynaptic serotonergic modulation of the retinogeniculate synapse occurred primarily through 5-HT1B receptors, resulting in inhibition of synaptic release and relief of synaptic depression. PMID: 15574745
  19. PrPC is a modulator of 5-HT receptor coupling to G-proteins and contributes to the homeostasis of serotonergic neurons PMID: 15590675
  20. results of the present study indicate that the dynamic modulation of 5-HT1B receptor function by p11 may be involved in molecular adaptations occurring in neuronal networks that are dysfunctional in depression-like states PMID: 16400147
  21. Knockout mice show changes in the increase in cortical serotonin outflow caused by systemic injection of paroxetine compared with normal mice. PMID: 16433012
  22. role of 5-HT1B receptors in photic entrainment PMID: 16461982
  23. Lack of serotonin1B receptor expression leads to age-related motor dysfunction, early onset of brain molecular aging and reduced longevity. PMID: 17420766
  24. Early-weaned mice were more aggressive after food restriction stress than were the normally weaned mice and had lower 5HT1B expression. PMID: 18022705
  25. These results suggest that 5-HT(1B) receptors in the mPFC may serve to selectively disinhibit aggressive behavior in mice with a history of Alc self-administration. PMID: 18305458
  26. Increases in D2 binding sites, presumably involving GABAergic projection neurons, were measured in the nucleus accumbens, olfactory tubercle and ventral tegmental area of the 5-HT1B KO. PMID: 18406571
  27. is a neurochemical basis for the behavioral sensitization. PMID: 18516987
  28. These results show that a prenatal 5-HT excess affects, via the overactivation of 5-HT(2A)-R, the expression of 5-HT(1B)-R in phrenic motor neurons and the organization of their premotor network. PMID: 18783379

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Predominantly expressed in striatum and Purkinje cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1