Recombinant Mouse 5-hydroxytryptamine receptor 6 (Htr6)

Code CSB-CF886433MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Htr6
Uniprot No.
Alternative Names
Htr6; 5-hydroxytryptamine receptor 6; 5-HT-6; 5-HT6; Serotonin receptor 6
Species
Mus musculus (Mouse)
Expression Region
1-440
Target Protein Sequence
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNT SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQC RLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQ VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCIS PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHS GARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF FVTDSVEPEIRQHPLGSPMN
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that function as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. It has a high affinity for tricyclic psychotropic drugs. Controls pyramidal neurons migration during corticogenesis, through the regulation of CDK5 activity. Is an activator of TOR signaling.
Gene References into Functions
  1. High 5-HT6R expression is associated with delayed bone development and regeneration. PMID: 27581523
  2. This study suggested that 5-HT6 plays a critical role in Alzheimer's disease development through regulating the morphology and function of neuronal primary cilia, which is possibly related to the AIS and axon alterations in Alzheimer's disease development. PMID: 28931427
  3. these findings suggest that disrupting 5-HT6 receptor-neurofibromin interaction prevents agonist-independent 5-HT6 receptor-operated cAMP signaling in prefrontal cortex, an effect that might underlie neuronal abnormalities in NF1 patients. PMID: 27791021
  4. Results implicate a role of 5-HT6 receptor signaling in primary cilia morphology, suggest that 5-HT6 receptor research should consider relative levels of receptor expression when evaluating their impact on primary cilia function. PMID: 28087224
  5. 5-HT6/7 receptor antagonist ADN-1184 displays anxiolytic-like activity in animal models of anxiety which employed punished stimuli. PMID: 26979176
  6. SNX14 is a dual endogenous negative regulator in 5-HT6R-mediated signaling pathway. PMID: 25795301
  7. Knockdown of MAO-A expression in embryos induces high serotonin levels and abnormal brain development, which can be rescued by inactivation of serotonin receptor-6. PMID: 24497636
  8. Coexpression of 5HT6 with adenylyl cyclase type III normalizes cilia structure and restores dendrite outgrowth. PMID: 23392690
  9. Serotonergic stimulation of 5-HT6 serotonin receptors augments extrapyramidal motor symptoms; antagonism of 5-HT6 receptors alleviates the symptoms. PMID: 20813116
  10. 5-HT6 receptors were expressed in embryonic mouse cortical interneurons and that 5-HT6 receptor activation decreased interneuron migration, whereas 5-HT6 receptor blockade prevented the migratory effects induced by 5-HT. PMID: 18663366

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1