Recombinant Mouse Adenosine receptor A1(Adora1)

Code CSB-CF723331MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q60612
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT QRRAAVAIAGCWILSLVVGLTPMFGWNNLSEVEQAWIANGSVGEPVIKCEFEKVISMEYM VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL KIWNDHFRCQPKPPIEEDIPEEKADD
Source in vitro E.coli expression system
Gene Names Adora1
Protein Names Recommended name: Adenosine receptor A1
Expression Region 1-326
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:11539

STRING: 10090.ENSMUSP00000043522

UniGene: Mm.298908

Pathway cAMP signaling pathway
cGMP-PKG signaling pathway
Sphingolipid signaling pathway

Related Products

Adora1 Proteins

Adora1 Proteins for Mus musculus (Mouse)

Adora1 ELISA Kit

Adora1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.