Recombinant Mouse Adrenocorticotropic hormone receptor (Mc2r)

Code CSB-CF723737MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Mc2r; Acthr; Adrenocorticotropic hormone receptor; ACTH receptor; ACTH-R; Adrenocorticotropin receptor; Melanocortin receptor 2; MC2-R
Species
Mus musculus (Mouse)
Expression Region
1-296
Target Protein Sequence
MKHIINSYEHTNDTARNNSDCPDVVLPEEIFFTISVIGILENLIVLLAVIKNKNLQSPMY FFICSLAISDMLGSLYKILENILIMFRNMGYLKPRGSFESTADDIIDCMFILSLLGSIFS LSVIAADRYITIFHALQYHSIVTMRRTIITLTIIWMFCTGSGITMVIFSHHIPTVLTFTS LFPLMLVFILCLYIHMFLLARSHARKISTLPRTNMKGAMTLTILLGVFIFCWAPFVLHVL LMTFCPNNPYCVCYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKRMLFCNRY
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for corticotropin (ACTH). This receptor is mediated by G proteins (G(s)) which activate adenylate cyclase (cAMP).
Gene References into Functions
  1. JDP2 acts as a novel transcriptional activator of the mouse Mc2r gene, suggesting that JDP2 may have physiological functions as a novel player in MC2R-mediated steroidogenesis as well as cell signaling in adrenal glands. PMID: 28146118
  2. Data show that neuromedin B (NMB) expression was higher in the melanocortin 2 receptor MC2R(-/-) than in the wild-type (WT) mice. PMID: 24742195
  3. MC2R plays an important role for regular lipolytic function and lipid composition in 3T3-L1 adipocytes. PMID: 22723268
  4. Functional melanocortin-2 receptors are expressed by mouse aorta-derived mesenchymal progenitor cells. PMID: 22306084
  5. melanocortin 2 receptor and melanocortin 5 receptor are lipolytic mediators in differentiated 3T3-L1 adipocytes PMID: 21616121
  6. MC2R+/- pups delivered from MC2R-/- females crossed with MC2R+/+ males mice thrived poorly with MC2R-/- mothers but grew to adulthood when transferred to foster mothers after birth, suggesting that MC2R-/- females are poor mothers or cannot nurse. PMID: 21303938
  7. The promoter activity of Mc2r is activated by FOXL2 in a dose-dependent manner; transcriptional activity of Mc2r is up-regulated by synergistic interaction of FOXL2 and NR5A1. PMID: 20650879
  8. MC2R in Y1 cells internalizes by a G protein coupled receptor kinase dependent clathrin-coated pit mechanism. PMID: 12530627
  9. Data show that adrenocorticotrophic hormone resistance in tumor cell mutants is associated with a base change polymorphism in the steroidogenic factor 1 gene. PMID: 12851310
  10. Novel 135-bp exon 1f of ACTH-R gene was located 1.4 kb downstream in genome of exon 1a transcribed in adrenal gland. Promoter region flanking to exon 1f may be essential for adipose tissue; that flanking to exon 1a is specific for the adrenal gland. PMID: 15004405
  11. a novel mechanism for mc2-r transcription, which may have significance in both adrenal and extra-adrenal sites of expression PMID: 15028712
  12. Mc2r expression is associated with a less aggressive tumor phenotype and anti-proliferative effects can be amplified through stimulation with physiological doses of ACTH. PMID: 16131607
  13. A CCAAT/enhancer-binding protein binding site, 87 bp upstream of the transcriptional initiation site, is necessary for the activity of Mc2R promoter. PMID: 16997835
  14. MC2-R gene is regulated both transcriptionally and post-transcriptionally during adipogenesis PMID: 17170082
  15. MC2R is required for postnatal adrenal development and adrenal steroidogenesis and that MC2R KO mice provide a useful animal model by which to study familial glucocorticoid deficiency PMID: 17989225
  16. The melanocortin 2 receptor accessory protein exists as a homodimer and is essential for the function of the melanocortin 2 receptor in the mouse y1 cell line. PMID: 18162519
  17. MRAP not only facilitates MC2 receptor trafficking but also allows properly localized receptor to bind ACTH and consequently signal. PMID: 18981183
  18. Results describe the phenotype of mice deficient in melanocortin 2 receptor on a B6/Balbc mix background. PMID: 19022343
  19. The results establish that MRAP forms stable complexes with two different melanocortin receptors, facilitating surface expression of MC2 receptor but disrupting dimerization and surface localization of MC5 receptor. PMID: 19535343

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1