Recombinant Mouse Amino acid transporter heavy chain SLC3A2 (Slc3a2), partial

Code CSB-CF021640MO4
Abbreviation Recombinant Mouse Slc3a2 protein, partial
MSDS
Size $878
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
4F2 cell-surface antigen heavy chain;Solute carrier family 3 member 2 ;CD98
Source
in vitro E.coli expression system
Expression Region
1-80aa
Target Protein Sequence
MSQDTEVDMKDVELNELEPEKQPMNAADGAAAGEKNGLVKIKVAEDETEAGVKFTGLSKEELLKVAGSPGWVRTRWALLL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.6 kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of several heterodimeric complexes involved in amino acid transport. The precise substrate specificity depends on the other subunit in the heterodimer. The complexes function as amino acid exchangers. The homodimer functions as sodium-independent, high-affinity transporter that mediates uptake of large neutral amino acids such as phenylalanine, tyrosine, L-DOPA, leucine, histidine, methionine and tryptophan. The heterodimer formed by SLC3A2 and SLC7A6 or SLC3A2 and SLC7A7 mediates the uptake of dibasic amino acids. The heterodimer with SLC7A5/LAT1 mediates the transport of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane. The heterodimer with SLC7A5/LAT1 is involved in the uptake of toxic methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes. The heterodimer with SLC7A5/LAT1 is involved in the uptake of leucine. When associated with LAPTM4B, the heterodimer with SLC7A5/LAT1 is recruited to lysosomes to promote leucine uptake into these organelles, and thereby mediates mTORC1 activation. The heterodimer with SLC7A5/LAT1 may play a role in the transport of L-DOPA across the blood-brain barrier. The heterodimer formed by SLC3A2 and SLC7A5/LAT1 or SLC3A2 and SLC7A8/LAT2 is involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Together with ICAM1, regulates the transport activity of SLC7A8/LAT2 in polarized intestinal cells by generating and delivering intracellular signals. Required for targeting of SLC7A5/LAT1 and SLC7A8/LAT2 to the plasma membrane and for channel activity. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. May mediate blood-to-retina L-leucine transport across the inner blood-retinal barrier.
Gene References into Functions
  1. Cell metabolism regulates integrin mechanosensing via an SLC3A2-dependent sphingolipid biosynthesis pathway. PMID: 30451822
  2. Slc3a2 is required for branched-chain amino-acid-dependent maintenance of Treg cells. PMID: 29141216
  3. CD98hc expression in vascular smooth muscle cells contributes to the formation of plaques that are morphologically more stable, and thereby protects against atherothrombosis. PMID: 28012647
  4. These results demonstrate a novel fundamental role of LAT1 to support the protein expression of 4F2hc via a chaperone-like function in chorionic trophoblasts. PMID: 28320871
  5. CD98 is required for endothelial cell growth. CD98-specific reagents could have a dual anticancer effect: directly by inhibiting tumor cell proliferation and indirectly by preventing tumor angiogenesis PMID: 27687603
  6. Taken together, our data indicate that T cell-specific deletion of CD98hc can contribute to the prevention of GvHD development due to the attenuation of lymphocyte migration and by increasing the generation of Treg cells. PMID: 26836475
  7. data establish CD98hc as a master protective gene at the cross-road of redox control and AA availability, making it a relevant therapeutic target in cancer. PMID: 26945935
  8. ubiquitylation and the resulting downregulation of CD98 can limit cell proliferation and clonal expansion. PMID: 26493331
  9. CD98hc mediated this stiffness sensing by increasing Rho kinase (ROCK) activity. PMID: 25267066
  10. Mice lacking CD98hc in B cells are protected from experimental autoimmune encephalomyelitis. PMID: 25002078
  11. CD98 heavy chain is crucial for T cell-mediated autoimmune colitis. CD98 heavy chain deficiency in T cells is involved in increasing induced regulatory T cells. PMID: 24491544
  12. The role of SLC3A2 in keratinocytes is not in cell adhesion but, instead, in cell proliferation and migration through modulating integrin signaling by the Src-RhoA pathway. PMID: 23296466
  13. CD98-dependent amino acid transport increased renal tubular epithelial cell proliferation is mediated by Erk and p38 MAPK signaling. PMID: 22768207
  14. Investigated the contribution of CD98 to intestinal tumorigenesis in Apc(Min/+) mice and the underlying mechanism of action. PMID: 22641098
  15. when the CD98hc deficient macrophages were stimulated with either IFN-gamma/LPS or IL-4, the production of NO(2) or arginase-I decreased in comparison to that observed in the control macrophages PMID: 22624878
  16. T cell-specific deficiency in CD98hc can contribute to cardiac allograft permanent acceptance correlating with the attenuation of lymphocyte migration and by increasing the generation of regulatory T cells. PMID: 22588539
  17. Taken together, these observations show that the combination of an inflammatory context and intestinal epithelial cell expression of CD98 affects the regulation of miRNA expression in colonic epithelial and immune cells. PMID: 22499850
  18. CD98 expression modulates intestinal homeostasis, inflammation, and colitis-associated cancer in mice PMID: 21490400
  19. Exogenous putrescine is transported into gastrointestinal tract by caveolin-1- and NOS2-dependent mechanisms. Solute carrier transporter SLC3A2 can function bidirectionally to import putrescine under conditions of low tissue polyamines. PMID: 20522643
  20. CD98 molecules are essential for mouse embryogenesis PMID: 12927796
  21. CD98 stimulation by anti-CD98 antibodies induced CEA-CAM-1-mediated cell adhesion PMID: 14527684
  22. Results demonstrate that xCT is a new member of the proteins whose transcriptional control by the amino acid deprivation is mediated by the amino acid response element. PMID: 15522208
  23. CD98 is a scaffolding protein that interacts with basolaterally expressed amino acid transporters and beta1 integrins and can alter amino acid transport and cell adhesion, migration and branching morphogenesis PMID: 15713750
  24. Results suggest that the CD98 system is independent of the interleukin-2/IL-2R system in murine T lymphocyte activation. PMID: 16707844
  25. the aromatic amino acid diffusion pathway TAT1 can control neutral amino acid efflux via neighboring exchanger LAT2-4F2hc, by recycling its aromatic influx substrates PMID: 17273864
  26. identified critical integrin residues required for CD98hc interaction that CD98c interaction with the integrin beta tail is required for its ability to mediate integrin signaling. PMID: 17597067
  27. CD98hc expression can vary widely; the data show that these variations in CD98hc expression can control the capacity of cells to assemble a fibronectin matrix, a process important in development, wound healing, and tumorigenesis. PMID: 17682053
  28. Reconstitution of CD98hc-deficient B cells with CD98hc mutants showed that the integrin-binding domain of CD98hc was required for B cell proliferation but that the amino acid-transport function of CD98hc was dispensable for this. PMID: 19270713
  29. These studies establish the importance of CD98hc in VSMC proliferation and survival. PMID: 19841087

Show More

Hide All

Subcellular Location
Apical cell membrane. Cell membrane; Single-pass type II membrane protein. Cell junction. Lysosome membrane. Melanosome.
Protein Families
SLC3A transporter family
Tissue Specificity
Detected on the surface of embryonic epithelial cells in the epidermis, thymus, kidney, intestine, brain choroid plexus, and in retina. Detected in adult and embryonic brain, spleen, kidney, intestine and liver, and in adult testis (at protein level). Obs
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*